Q9NNX9

Homosapiens Y Chromosome Protein


 

Protein Sequence

>Q9NNX9|VCX3_HUMAN Variable charge X-linked protein 3 - Homo sapiens (Human)

MSPKPRASGPPAKATEAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMA

AVTAPEAESGPAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPLSQESELEEPLSQESEV

EEPLSQESQVEEPLSQESEVEEPLSQESQVEEPLSQESEVEEPLSQESQVEEPLSQESEM

EELPSV

Primary Structure

Compute pI

              Theoretical pI        4.51  

              Molecular weight    20019.75 (Daltons)

Protparam 

              Formula                 C844H1370N238O317S3

              Sequence Length    186

              Total Atoms            2772

Secondary Structure

 GOR, HNN & SOPMA

GOR

HNN

SOPMA

Alpha Helix

Extended Strand

Random Coil

Alpha Helix

Extended Strand

Random Coil

Alpha Helix

Extended Strand

Beta Turn

Random Coil

36.02
3.76
60.22
10.22
0.00
89.78
43.01
3.76
4.30
48.92

Tertiary Structure Prediction

I-TASSER 

3-D Structure predicted By I-tasser server(Ab initio method) = Q9NNX9

-----The estimate of Q9NNX9 -----------
 #model      :   C-score     TM-score         RMSD (in Angstroms)
 Q9NNX9 :   -2.96        0.38 +- 0.13  12.0 +- 4.4

      C-score is a confidence score of the I-TASSER predictions which is typically in [-5,2]. TM-score and RMSD measure how close the model is to the native structure and both are estimated based on the C-score. TM-score is in [0,1] with a value >0.5 implying the model of correct topology. The TM-score and RMSD estimations are made only for the first model because absolute values of TM-score and RMSD for the lower-rank models do not strongly correlate with the C-score. The models are ranked based on the structure density of I-TASSER simulations. Please cite following articles when you use the I-TASSER server:

  1) Yang Zhang. I-TASSER server for protein 3D structure prediction.
   BMC Bioinformatics, 9:40 (2008).
  2) Yang Zhang. Template-based modeling and free modeling by
   I-TASSER in CASP7. Proteins, 8: 108-117 (2007).
  3) Sitao Wu, Jeffrey Skolnick, Yang Zhang. Ab initio modeling of
   small proteins by iterative TASSER simulations. BMC Biology,
   5:17 (2007).

Structure Validation

PROCHECK

           Saves Result : Procheck Summary                                      Ramachandran Plot: Plot Statistics

Function Prediction

Interproscan

GOG

Pfam

Blast

Unintegrated
No Hits Circovirus protein of unknown function (DUF765) No putative conserved domains have been detected

                     Home