>A6NCS7|A6NCS7_HUMAN Uncharacterized protein UTY - Homo sapiens (Human)

MKSCAVSLTTAAVAFGDEAKKMAEGKASRESEEESVSLTVEEREALGGMDSRLFGFVRLH

EDGARTKTLLGKAVRCYESLILKAEGKVESDFFCQLGHFNLLLEDYSKALSAYQRYYSLQ

ADYWKNAAFLYGLGLVYFYYNAFHWAIKAFQDVLYVDPSFCRAKEIHLRLGLMFKVNTDY

KSSLKHFQLALIDCNPCTLSNAESKYF

Primary Structure

Compute pI

              Theoretical pI     6.52

              Molecular weight   23515.89 (Daltons)

Protparam 

            Formula                 C₁₀₆₆H₁₆₂₇N₂₇₃O₃₀₈S₁₀

            Sequence Length    207

            Total Atoms           3284

_{Secondary Structure}

 _{GOR, HNN & SOPMA}

GOR			HNN			SOPMA
Alpha Helix	Extended Strand	Random Coil	Alpha Helix	Extended Strand	Random Coil	Alpha Helix	Extended Strand	Beta Turn	Random Coil
54.59	11.11	34.30	62.80	9.18	28.02	63.77	13.04	7.73	15.46

_{Tertiary Structure Prediction}

3-D Structure predicted By I-tasser server(Ab initio method) = A6NCS7

-----The estimate of A6NCS7-----------

 #model    : C-score   TM-score        RMSD (in Angstroms)
A6NCS7 : 0.07       0.72 +- 0.11    5.3 +- 3.4

      C-score is a confidence score of the I-TASSER predictions which is typically in [-5,2]. TM-score and RMSD measure how close the model is to the native structure and both are estimated based on the C-score. TM-score is in [0,1] with a value >0.5 implying the model of correct topology. The TM-score and RMSD estimations are made only for the first model because absolute values of TM-score and RMSD for the lower-rank models do not strongly correlate with the C-score. The models are ranked based on the structure density of I-TASSER simulations.Please cite following articles when you use the I-TASSER server:

  1) Yang Zhang. I-TASSER server for protein 3D structure prediction.
   BMC Bioinformatics, 9:40 (2008).
  2) Yang Zhang. Template-based modeling and free modeling by
   I-TASSER in CASP7. Proteins, 8: 108-117 (2007).
  3) Sitao Wu, Jeffrey Skolnick, Yang Zhang. Ab initio modeling of
   small proteins by iterative TASSER simulations. BMC Biology,
   5:17 (2007).

Structure Validation

PROCHECK

           Saves Result : Procheck Summary                                     Ramachandran Plot: Plot Statistics

 Predicted Function

Interproscan	GOG	Pfam	Blast
Tetratricopeptide TPR-1, Tetratricopeptide region,	NO related COG	Tetratricopeptide repeat	TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids