Protein Sequence
>A6NCS7|A6NCS7_HUMAN Uncharacterized protein UTY - Homo sapiens (Human)
MKSCAVSLTTAAVAFGDEAKKMAEGKASRESEEESVSLTVEEREALGGMDSRLFGFVRLH
EDGARTKTLLGKAVRCYESLILKAEGKVESDFFCQLGHFNLLLEDYSKALSAYQRYYSLQ
ADYWKNAAFLYGLGLVYFYYNAFHWAIKAFQDVLYVDPSFCRAKEIHLRLGLMFKVNTDY
KSSLKHFQLALIDCNPCTLSNAESKYF
Primary Structure
Compute pI
Theoretical pI 6.52
Molecular weight 23515.89 (Daltons)
Protparam
Formula C1066H1627N273O308S10
Sequence Length 207
Total Atoms 3284
Secondary Structure
GOR, HNN & SOPMA
GOR |
HNN |
SOPMA |
|||||||
Alpha Helix |
Extended Strand |
Random Coil |
Alpha Helix |
Extended Strand |
Random Coil |
Alpha Helix |
Extended Strand |
Beta Turn |
Random Coil |
54.59 |
11.11 |
34.30 |
62.80 |
9.18 |
28.02 |
63.77 |
13.04 |
7.73 |
15.46 |
Tertiary Structure Prediction
3-D Structure predicted By I-tasser server(Ab initio method) = A6NCS7
-----The estimate of A6NCS7-----------
#model : C-score TM-score RMSD (in Angstroms)
A6NCS7 : 0.07 0.72 +- 0.11 5.3 +- 3.4
C-score is a confidence score of the I-TASSER predictions which is
typically in [-5,2]. TM-score and RMSD measure how close the model is
to the native structure and both are estimated based on the C-score.
TM-score is in [0,1] with a value >0.5 implying the model of correct
topology. The TM-score and RMSD estimations are made only for the first
model because absolute values of TM-score and RMSD for the lower-rank
models do not strongly correlate with the C-score. The models are
ranked based on the structure density of I-TASSER simulations.Please
cite following articles when you use the I-TASSER server:
1) Yang Zhang. I-TASSER server for protein 3D structure prediction.
BMC Bioinformatics, 9:40 (2008).
2) Yang Zhang. Template-based modeling and free modeling by
I-TASSER in CASP7. Proteins, 8: 108-117 (2007).
3) Sitao Wu, Jeffrey Skolnick, Yang Zhang. Ab initio modeling of
small proteins by iterative TASSER simulations. BMC Biology,
5:17 (2007).
Structure Validation
PROCHECK
Saves Result : Procheck Summary Ramachandran Plot: Plot Statistics
Predicted Function
Interproscan |
GOG |
Pfam |
Blast |
Tetratricopeptide TPR-1, Tetratricopeptide region, |
NO related COG | Tetratricopeptide repeat | TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids |