q9bxh5-2

Q9BXH5-2

Homosapiens Y Chromosome Protein

Protein Sequence

>Q9BXH5-2|TTY6_HUMAN Isoform 2 of Q9BXH5 - Homo sapiens (Human)

MHLHRGLLLSQASGNCGIHAVPVICSHWRRRCLDCDGVSENCSSDFIPERGCVQELSPRG

TGMLSVLQGLLVKWRNHDKGKSKVEQYSHSSKWTPTGAGECVGPHPPLTSLYPHLYLMLW

LLKVSVPK

Primary Structure

Compute pI

Theoretical pI 8.93

Molecular weight 14213.49 (Daltons)

Protparam

Formula C₆₂₇H₉₉₁N₁₈₃O₁₇₅S₁₀

Sequence Length 128

Total Atoms 1986

_{Secondary Structure}

_{GOR, HNN & SOPMA}

_{Tertiary Structure Prediction}

I-TASSER

3-D Structure predicted By I-tasser server(Ab initio method) = Q9BXH5-2

-----The estimate of Q9BXH5-2 -----------

#model : C-score TM-score RMSD (in Angstroms)

Q9BXH5-2 : -3.22 0.35 +- 0.12 11.8 +- 4.5

C-score is a confidence score of the I-TASSER predictions which is typically in [-5,2]. TM-score and RMSD measure how close the model is to the native structure and both are estimated based on the C-score. TM-score is in [0,1] with a value >0.5 implying the model of correct topology. The TM-score and RMSD estimations are made only for the first model because absolute values of TM-score and RMSD for the lower-rank models do not strongly correlate with the C-score. The models are ranked based on the structure density of I-TASSER simulations. Please cite following articles when you use the I-TASSER server:

1) Yang Zhang. I-TASSER server for protein 3D structure prediction.

BMC Bioinformatics, 9:40 (2008).

2) Yang Zhang. Template-based modeling and free modeling by

I-TASSER in CASP7. Proteins, 8: 108-117 (2007).

3) Sitao Wu, Jeffrey Skolnick, Yang Zhang. Ab initio modeling of

small proteins by iterative TASSER simulations. BMC Biology,

5:17 (2007).

Structure Validation

PROCHECK

Saves Result : Procheck Summary Ramachandran Plot: Plot Statistics

Function Prediction

Home