A6NFC0

Homosapiens Y Chromosome Protein


 

Protein Sequence

>tr|A6NFC0|A6NFC0_HUMAN Uncharacterized protein ENSP00000305182 (Fragment) OS=Homo sapiens

RQGSCGVGRAAQVVVCGSPEKGTVFRMEALQEGAPGAQSEEAAWVEEAVLVLDDIITEVE

VVAQEEADVERLEEDQRAQLGPGPMTPESTLEELLAIQVELEPVNAGASKAFSQQRGKME

RRRKPHLDRRGSFIQSIPGFLASVIANHLQMSALISDQDEDMLSYMINLEVKEAKHSVHL

CKIMLFFWSNPYFQNQVITKEYLMNLTEYRASHSTPIQRYPNYEVEAYRHRHHNRRLNFF

NWFSDHDFAGSNRIAEVDPHWETHLKYCTRMKPPEERTEISGDSQILS

Primary Structure

Compute pI

          Theoretical pI  5.28

           Molecular weight    32886.98 (Daltons)

Protparam 

           Formula                       C1443H2246N412O444S13

               Sequence Length      288

               Total Atoms               4558

Secondary Structure

 GOR, HNN & SOPMA

GOR

HNN

SOPMA

Alpha Helix

Extended Strand

Random Coil

Alpha Helix

Extended Strand

Random Coil

Alpha Helix

Extended Strand

Beta Turn

Random Coil

45.14 10.07 44.79 47.92 9.72 42.36 44.79 9.72 2.78 42.71

Tertiary Structure Prediction

I-TASSER 

3-D Structure predicted By I-tasser server(Ab initio method) = A6NFC0

-----The estimate of  A6NFC0-----------

 #model : C-score   TM-score        RMSD (in Angstroms)
 A6NFC0: -2.43    0.43+-0.14    11.8+-4.5

      C-score is a confidence score of the I-TASSER predictions which is typically in [-5,2]. TM-score and RMSD measure how close the model is to the native structure and both are estimated based on the C-score. TM-score is in [0,1] with a value >0.5 implying the model of correct topology. The TM-score and RMSD estimations are made only for the first model because absolute values of TM-score and RMSD for the lower-rank models do not strongly correlate with the C-score. The models are ranked based on the structure density of I-TASSER simulations. Please cite following articles when you use the I-TASSER server:

  1) Yang Zhang. I-TASSER server for protein 3D structure prediction.
   BMC Bioinformatics, 9:40 (2008).
  2) Yang Zhang. Template-based modeling and free modeling by
   I-TASSER in CASP7. Proteins, 8: 108-117 (2007).
  3) Sitao Wu, Jeffrey Skolnick, Yang Zhang. Ab initio modeling of
   small proteins by iterative TASSER simulations. BMC Biology,
   5:17 (2007).

Structure Validation

PROCHECK

           Saves Result : Procheck Summary                                      Ramachandran Plot: Plot Statistics

Function Prediction

Interproscan

GOG

Pfam

Blast

Nucleosome assembly protein (NAP), unintegrated No relative Cog
FCD domain, Nucleosome assembly protein (NAP) NAP, Nucleosome assembly protein (NAP)

                     Home