A6NEC3

Homosapiens Y Chromosome Protein


 

Protein Sequence

>tr|A6NEC3|A6NEC3_HUMAN Uncharacterized protein ENSP00000372471 OS=Homo sapiens
MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALG
EEAVLLLDDIMAEVEVVAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESALEELLA
VQVELEPVNAQARKAFSRQREKMERRRKPHLDRRGAVIQSVPGFWANVIANHPQMSALIT
DEDEDMLSYMVSLEVEEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTP
IEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAESPDRSYVRTCGAIPCNTTRG

Primary Structure

Compute pI

             Theoretical pI   5.21

             Molecular weight    33884.16 (Daltons)

Protparam 

            Formula                 C1481H2322N428O457S14

            Sequence Length    142

            Total Atoms           2339

Secondary Structure

 GOR, HNN & SOPMA

GOR

HNN

SOPMA

Alpha Helix

Extended Strand

Random Coil

Alpha Helix

Extended Strand

Random Coil

Alpha Helix

Extended Strand

Beta Turn

Random Coil

47.00 14.67 38.33 50.00 10.33 39.67 50.67 10.67 4.00 34.67

Tertiary Structure Prediction

3-D Structure predicted By I-tasser server(Ab initio method) = A6NEC3

-----The estimate of A6NEC3-----------

 #model    : C-score   TM-score          RMSD (in Angstroms)
A6NEC3 : -2.87 0.39+-0.13 13.1+-4.2

      C-score is a confidence score of the I-TASSER predictions which is typically in [-5,2]. TM-score and RMSD measure how close the model is to the native structure and both are estimated based on the C-score. TM-score is in [0,1] with a value >0.5 implying the model of correct topology. The TM-score and RMSD estimations are made only for the first model because absolute values of TM-score and RMSD for the lower-rank models do not strongly correlate with the C-score. The models are ranked based on the structure density of I-TASSER simulations.Please cite following articles when you use the I-TASSER server:

  1) Yang Zhang. I-TASSER server for protein 3D structure prediction.
   BMC Bioinformatics, 9:40 (2008).
  2) Yang Zhang. Template-based modeling and free modeling by
   I-TASSER in CASP7. Proteins, 8: 108-117 (2007).
  3) Sitao Wu, Jeffrey Skolnick, Yang Zhang. Ab initio modeling of
   small proteins by iterative TASSER simulations. BMC Biology,
   5:17 (2007).

Structure Validation

PROCHECK

           Saves Result : Procheck Summary                                     Ramachandran Plot: Plot Statistics

 Predicted Function

Interproscan

GOG

Pfam

Blast

Nucleosome assembly protein (NAP), unintegrated


NO related COG Nucleosome assembly protein (NAP). Nucleosome assembly protein (NAP).
                     Home