Homosapiens Y Chromosome Protein
>tr|A6NEQ7|A6NEQ7_HUMAN Uncharacterized protein ENSP00000344396 (Fragment) OS=Homo sapiens
TSPIPFHQYHIKLSHLRRIHRAVLYGSLQKLNYLLSTYHDANKRDKKGRTALHLACATVQ
PEMVFLLVSTRCELNLCDRECRTPLIKAVQLGQEAFATILLPNGADPNIMDFFGRTALHY
AVYNEDTSMIEKLLLHGTNIEECSKTECQPLLLAVRLRKLIMVEVLLNKNANINAIDCLS
RSALILAVTLGEKDIVILLLKHNIDVFSQDVYGQTAEDYAIGAGNRVLFGSQNVQ
Compute pI
Theoretical pI 8.14
Molecular weight 26398.71 (Daltons)
Protparam
Formula C1176H1904N328O338S11
Sequence Length 235
Total Atoms 3757
GOR, HNN & SOPMA
I-TASSER
3-D Structure predicted By I-tasser server(Ab initio method) = A6NEQ7
-----The estimate of A6NEQ7-----------
#model : C-score TM-score RMSD (in Angstroms)
A6NEQ7 : 0.84 0.83+-0.08 4.0+-2.7
C-score is a confidence score of the I-TASSER predictions which is typically in [-5,2]. TM-score and RMSD measure how close the model is to the native structure and both are estimated based on the C-score. TM-score is in [0,1] with a value >0.5 implying the model of correct topology. The TM-score and RMSD estimations are made only for the first model because absolute values of TM-score and RMSD for the lower-rank models do not strongly correlate with the C-score. The models are ranked based on the structure density of I-TASSER simulations. Please cite following articles when you use the I-TASSER server:
1) Yang Zhang. I-TASSER server for protein 3D structure prediction.
BMC Bioinformatics, 9:40 (2008).
2) Yang Zhang. Template-based modeling and free modeling by
I-TASSER in CASP7. Proteins, 8: 108-117 (2007).
3) Sitao Wu, Jeffrey Skolnick, Yang Zhang. Ab initio modeling of
small proteins by iterative TASSER simulations. BMC Biology,
5:17 (2007).
PROCHECK
Saves Result : Procheck Summary Ramachandran Plot: Plot Statistics
This webpage was best viewed in Mozilla Firefox 3.05