A8MUH9

Homosapiens Y Chromosome Protein


 

Protein Sequence

>A2RUG3|XKRY2_HUMAN Testis-specific XK-related protein, Y-linked 2 - Homo sapiens (Human)
MFIFNSIADDIFPLISCVGAIHCNILAIRTGNDFAAIKLQVIKLIYLMIWHSLVIISPVV
TLAFFPASLKQGSLHFLLIIYFVLLLTPWLEFSKSGTHLPSNTKNNSSMVGKYGCLS

Primary Structure

Compute pI

           Theoretical pI         8.91

           Molecular weight     12987.55 (Daltons)

Protparam 

          Formula                  C612H956N144O154S6

             Sequence Length           117

             Total Atoms                   1872

Secondary Structure

 GOR, HNN & SOPMA

GOR

HNN

SOPMA

Alpha Helix

Extended Strand

Random Coil

Alpha Helix

Extended Strand

Random Coil

Alpha Helix

Extended Strand

Beta Turn

Random Coil

23.08

27.35

 49.57

51.28

13.68

 35.04

 52.14

24.79

2.56

 20.51

Tertiary Structure Prediction

3-D Structure predicted By I-tasser server(Ab initio method) = A2RUG3.pdb

  -----The estimate of A2RUG3-----------

 #model : C-score TM-score RMSD (in Angstroms)
A2RUG3 : -3.48 0.33+-0.11 12.2+- 4

      C-score is a confidence score of the I-TASSER predictions which is typically in [-5,2]. TM-score and RMSD measure how close the model is to the native structure and both are estimated based on the C-score. TM-score is in [0,1] with a value >0.5 implying the model of correct topology. The TM-score and RMSD estimations are made only for the first model because absolute values of TM-score and RMSD for the lower-rank models do not strongly correlate with the C-score. The models are ranked based on the structure density of I-TASSER simulations.Please cite following articles when you use the I-TASSER server:

  1) Yang Zhang. I-TASSER server for protein 3D structure prediction.
   BMC Bioinformatics, 9:40 (2008).
  2) Yang Zhang. Template-based modeling and free modeling by
   I-TASSER in CASP7. Proteins, 8: 108-117 (2007).
  3) Sitao Wu, Jeffrey Skolnick, Yang Zhang. Ab initio modeling of
   small proteins by iterative TASSER simulations. BMC Biology,
   5:17 (2007).

 Predicted Function

Interproscan

GOG

Pfam

Blast

Unintegrated
No relative Cog
No hits
No putative domains
                     Home