Q24JR0

Homosapiens Y Chromosome Protein


 

Protein Sequence

>Q24JR0|Q24JR0_HUMAN ZFY protein - Homo sapiens (Human)

MDGDQIVVEIQEAVFVSNIVDSDITVHNFVPDDPDSVVIQDVVEDVVIEEDVQCSDILEE

ADVSENVIIPEQVLDSDVTEEVSLPHCTVPDDVLASDITSTSMSMPEHVLTSESMHVCDI

GHVEHMVHDSVVEAEIITDPLTSDIVSEEVLVADCAPEAVIDASGISVDQQDNDKASCED

YLMISLDDAGKIEHDGSTGVTIDAESEMDPCKVDSTCPEVIKVYIFKADPGEDDLGGTVD

IVESEPENDHGVELLDQNSSIRVPREKMVYMTVNDSQQEDEDLSNNSDGIENRNGTASAL

LHIDESAGLGRLAKQKPKKKRRPDSRQYQTAIIIGPDGHPLTVYPCMICGKKFKSRGFLK

RHMKNHPEHLAKKKYHCTDCDYTTNKKISLHNHLESHKLTSKAEKAIECDECGKHFSHAG

ALFTHKMVHKEKGANKMHKCKFCEYETAEQGLLNRHLLAVHSKNFPHICVECGKGFRHPS

ELRKHMRIHTGEKPYQCQYCEYRSADSSNLKTHIKTKHSKEMPFKCDICLLTFSDTKEVQ

QHTLVHQESKTHQCLHCDHKSSNSSDLKRHVISVHTKDYPHKCEMCEKGFHRPSELKKHV

AVHKGKKMHQCRHCDFKIADPFVLSRHILSVHTKDLPFRCKRCRKGFRQQNELKKHMKTH

SGRKVYQCEYCEYSTTDASGFKRHVISIHTKDYPHRCEYCKKGFRRPSEKNQHIMRHHKE

VGLP

Primary Structure

Compute pI

              Theoretical pI        6.10

              Molecular weight    82164.83 (Daltons)

Protparam 

              Formula                 C3542H5608N1028O1119S52

              Sequence Length    724

              Total Atoms           11349

Secondary Structure

 GOR, HNN & SOPMA

GOR

HNN

SOPMA

Alpha Helix

Extended Strand

Random Coil

Alpha Helix

Extended Strand

Random Coil

Alpha Helix

Extended Strand

Beta Turn

Random Coil

20.99
25.00
54.01
17.54
23.62
58.84
26.10
15.61
6.08
52.21

Tertiary Structure Prediction

I-TASSER 

3-D Structure predicted By I-tasser server(Ab initio method) = Q24JR0

-----The estimate of Q24JR0 -----------
 #model  :   C-score    TM-score           RMSD (in Angstroms)
 A2RUG3 :   -2.67      0.41 +- 0.14    14.9 +- 3.6       

      C-score is a confidence score of the I-TASSER predictions which is typically in [-5,2]. TM-score and RMSD measure how close the model is to the native structure and both are estimated based on the C-score. TM-score is in [0,1] with a value >0.5 implying the model of correct topology. The TM-score and RMSD estimations are made only for the first model because absolute values of TM-score and RMSD for the lower-rank models do not strongly correlate with the C-score. The models are ranked based on the structure density of I-TASSER simulations. Please cite following articles when you use the I-TASSER server:

  1) Yang Zhang. I-TASSER server for protein 3D structure prediction.
   BMC Bioinformatics, 9:40 (2008).
  2) Yang Zhang. Template-based modeling and free modeling by
   I-TASSER in CASP7. Proteins, 8: 108-117 (2007).
  3) Sitao Wu, Jeffrey Skolnick, Yang Zhang. Ab initio modeling of
   small proteins by iterative TASSER simulations. BMC Biology,
   5:17 (2007).

Structure Validation

PROCHECK

           Saves Result : Procheck Summary                                        Ramachandran Plot: Plot Statistics

Function Prediction

Interproscan

GOG

Pfam

Blast

Zfx / Zfy transcription activation region, Zinc finger, C2H2-type, Zinc finger, C2H2-type/integrase, DNA-binding, Zinc finger, C2H2-like,unintegrated No related COG Zfx / Zfy transcription activation region, Protein of unknown function (DUF673), BED zinc finger, Transcription factor S-II (TFIIS), Zinc finger, C2H2 type, Ribosomal protein L19e, XPA protein N-terminal, MYM-type Zinc finger, Sec23/Sec24 zinc finger Zfx_Zfy_act, Zfx / Zfy transcription activation region. Zfx and Zfy are transcription factors., FOG: Zn-finger

                     Home