Q496E4

Homosapiens Y Chromosome Protein


 

Protein Sequence

>Q496E4|Q496E4_HUMAN Ribosomal protein S4, Y-linked 1 - Homo sapiens (Human)

MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDE

VKKICMQRFIKIDGKVRVDVTYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITVEEAK

YKLCKVRKITVGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNL

CMVIGGANLGRVGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGNGNKPWISLPR

GKGIRLTVAEERDKRLAAKQSSG

Primary Structure

Compute pI

          Theoretical pI         10.25

          Molecular weight     29425.59 (Daltons)

Protparam 

          Formula                 C1321H2157N389O353S9 

          Sequence Length    263 

          Total Atoms           4229

Secondary Structure

 GOR, HNN & SOPMA

GOR

HNN

SOPMA

Alpha Helix

Extended Strand

Random Coil

Alpha Helix

Extended Strand

Random Coil

Alpha Helix

Extended Strand

Beta Turn

Random Coil

24.33
28.52
47.15
25.48
34.60
39.92
23.19
31.56
10.27
34.98

Tertiary Structure Prediction

I-TASSER 

3-D Structure predicted By I-tasser server(Ab initio method) = Q496E4

-----The estimate of Q496E4-----------

 #model :  C-score   TM-score          RMSD (in Angstroms)
Q496E4 :  -3.85      0.30 +- 0.10   15.4 +- 3.4

      C-score is a confidence score of the I-TASSER predictions which is typically in [-5,2]. TM-score and RMSD measure how close the model is to the native structure and both are estimated based on the C-score. TM-score is in [0,1] with a value >0.5 implying the model of correct topology. The TM-score and RMSD estimations are made only for the first model because absolute values of TM-score and RMSD for the lower-rank models do not strongly correlate with the C-score. The models are ranked based on the structure density of I-TASSER simulations. Please cite following articles when you use the I-TASSER server:

  1) Yang Zhang. I-TASSER server for protein 3D structure prediction.
   BMC Bioinformatics, 9:40 (2008).
  2) Yang Zhang. Template-based modeling and free modeling by
   I-TASSER in CASP7. Proteins, 8: 108-117 (2007).
  3) Sitao Wu, Jeffrey Skolnick, Yang Zhang. Ab initio modeling of
   small proteins by iterative TASSER simulations. BMC Biology,
   5:17 (2007).

Structure Validation

PROCHECK

           Saves Result : Procheck Summary                                      Ramachandran Plot: Plot Statistics

Function Prediction

Interproscan

COG

Pfam

Blast

Ribosomal protein S4e, RNA-binding S4, KOW, Ribosomal protein S4e, N-terminal, Ribosomal protein S4e, N-terminal and RNA-binding, Ribosomal protein S4e, central Ribosomal protein S4E RS4NT (NUC023) domain, S4 domain, Ribosomal family S4e, Fertility inhibition protein (FINO), KOW motif, Putative tRNA binding domain Ribosomal family S4e., 30S ribosomal protein S4e

                     Home