A6NIW1
Homosapiens Y Chromosome Protein
Protein Sequence
>A2RUG3|XKRY2_HUMAN Testis-specific XK-related protein, Y-linked 2 - Homo sapiens (Human)
MFIFNSIADDIFPLISCVGAIHCNILAIRTGNDFAAIKLQVIKLIYLMIWHSLVIISPVV
TLAFFPASLKQGSLHFLLIIYFVLLLTPWLEFSKSGTHLPSNTKNNSSMVGKYGCLS
Compute pI
Theoretical pI 8.91
Molecular weight 12987.55 (Daltons)
Protparam
Formula C612H956N144O154S6
Sequence Length 117
Total Atoms 1872
GOR, HNN & SOPMA
3-D Structure predicted By I-tasser server(Ab initio method) = A2RUG3.pdb
-----The estimate of A2RUG3-----------
#model : C-score TM-score RMSD (in Angstroms)
A2RUG3 : -3.48 0.33+-0.11 12.2+- 4
C-score is a confidence score of the I-TASSER predictions which is typically in [-5,2]. TM-score and RMSD measure how close the model is to the native structure and both are estimated based on the C-score. TM-score is in [0,1] with a value >0.5 implying the model of correct topology. The TM-score and RMSD estimations are made only for the first model because absolute values of TM-score and RMSD for the lower-rank models do not strongly correlate with the C-score. The models are ranked based on the structure density of I-TASSER simulations.Please cite following articles when you use the I-TASSER server:
1) Yang Zhang. I-TASSER server for protein 3D structure prediction.
BMC Bioinformatics, 9:40 (2008).
2) Yang Zhang. Template-based modeling and free modeling by
I-TASSER in CASP7. Proteins, 8: 108-117 (2007).
3) Sitao Wu, Jeffrey Skolnick, Yang Zhang. Ab initio modeling of
small proteins by iterative TASSER simulations. BMC Biology,
5:17 (2007).