A6NFK1

Homosapiens Y Chromosome Protein


 

Protein Sequence

>tr|A6NFK1|A6NFK1_HUMAN Uncharacterized protein ENSP00000342904 OS=Homo sapiens

MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALG

EEAVLLLDDIMAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESAPEELLAVQVELE

PVNAQARKAFSRQREKMERRRKPHLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDM

LSYMVSLEVGEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPD

YEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDLWRNPLQYYKRMKPPEEGTET

SGEPLVGT

Primary Structure

Compute pI

            Theoretical  pI      5.29

           Molecular weight    34965.49 (Daltons)

Protparam 

           Formula                       C1538H2402N438O468S14

               Sequence Length      308

               Total                            4860

Secondary Structure

 GOR, HNN & SOPMA

GOR

HNN

SOPMA

Alpha Helix

Extended Strand

Random Coil

Alpha Helix

Extended Strand

Random Coil

Alpha Helix

Extended Strand

Beta Turn

Random Coil

45.13 12.34 42.53 51.95 8.77 39.29 51.30 8.44 3.57 36.69

Tertiary Structure Prediction

I-TASSER 

3-D Structure predicted By I-tasser server(Ab initio method) = A6NFK1

-----The estimate of  A6NFK1-----------
 #model :  C-score    TM-score       RMSD (in Angstroms)
 A6NFK1 : -2.57   0.42+-0.14  12.3+-4.3

      C-score is a confidence score of the I-TASSER predictions which is typically in [-5,2]. TM-score and RMSD measure how close the model is to the native structure and both are estimated based on the C-score. TM-score is in [0,1] with a value >0.5 implying the model of correct topology. The TM-score and RMSD estimations are made only for the first model because absolute values of TM-score and RMSD for the lower-rank models do not strongly correlate with the C-score. The models are ranked based on the structure density of I-TASSER simulations. Please cite following articles when you use the I-TASSER server:

  1) Yang Zhang. I-TASSER server for protein 3D structure prediction.
   BMC Bioinformatics, 9:40 (2008).
  2) Yang Zhang. Template-based modeling and free modeling by
   I-TASSER in CASP7. Proteins, 8: 108-117 (2007).
  3) Sitao Wu, Jeffrey Skolnick, Yang Zhang. Ab initio modeling of
   small proteins by iterative TASSER simulations. BMC Biology,
   5:17 (2007).

Structure Validation

PROCHECK

           Saves Result : Procheck Summary                                      Ramachandran Plot: Plot Statistics

Function Prediction

Interproscan

GOG

Pfam

Blast

Nucleosome assembly protein (NAP), unintegrated NO related COG Nucleosome assembly protein (NAP) NAP, Nucleosome assembly protein (NAP)

                     Home