Q9BZ99

Homosapiens Y Chromosome Protein


 

Protein Sequence

>Q9BZ99|TTY11_HUMAN Putative transcript Y 11 protein - Homo sapiens (Human)

MVHHLSEGLGCLMVEAAAMIITIHEIDTAEVRKVAQGAMAIFILVVMRTLAEKTKGIHLL

WIGCTLLLLKHMVVQVMCHLQEMVGKVNLKKATKADFKPERCCFRETRQQHHSATTSRG

Primary Structure

Compute pI

              Theoretical pI        9.14

              Molecular weight    13333.01 (Daltons)

Protparam 

              Formula                 C586H975N169O158S13

              Sequence Length    119

              Total Atoms            13333.01    

Secondary Structure

 GOR, HNN & SOPMA

GOR

HNN

SOPMA

Alpha Helix

Extended Strand

Random Coil

Alpha Helix

Extended Strand

Random Coil

Alpha Helix

Extended Strand

Beta Turn

Random Coil

41.18
26.89
31.93
69.75
3.36
26.89
63.87
10.08
1.68
24.37

Tertiary Structure Prediction

I-TASSER 

3-D Structure predicted By I-tasser server(Ab initio method) = Q9BZ99

-----The estimate of Q9BZ99-----------
 #model   :   C-score     TM-score          RMSD (in Angstroms)
Q9BZ99 :   -3.86        0.30 +- 0.10   13.2 +- 4.1

      C-score is a confidence score of the I-TASSER predictions which is typically in [-5,2]. TM-score and RMSD measure how close the model is to the native structure and both are estimated based on the C-score. TM-score is in [0,1] with a value >0.5 implying the model of correct topology. The TM-score and RMSD estimations are made only for the first model because absolute values of TM-score and RMSD for the lower-rank models do not strongly correlate with the C-score. The models are ranked based on the structure density of I-TASSER simulations. Please cite following articles when you use the I-TASSER server:

  1) Yang Zhang. I-TASSER server for protein 3D structure prediction.
   BMC Bioinformatics, 9:40 (2008).
  2) Yang Zhang. Template-based modeling and free modeling by
   I-TASSER in CASP7. Proteins, 8: 108-117 (2007).
  3) Sitao Wu, Jeffrey Skolnick, Yang Zhang. Ab initio modeling of
   small proteins by iterative TASSER simulations. BMC Biology,
   5:17 (2007).

Structure Validation

PROCHECK

           Saves Result : Procheck Summary                                      Ramachandran Plot: Plot Statistics

Function Prediction

Interproscan

GOG

Pfam

Blast

No Hits reported
No relative Cog
No related hits
No putative Conserved domains have been identified

                     Home