q9bz97
Q9BZ97
Homosapiens Y Chromosome Protein
Protein Sequence
>Q9BZ97|TTY13_HUMAN Putative transcript Y 13 protein - Homo sapiens (Human)
MKTQDDGVLPPYDVNQLLGWDLNLSLFLGLCLMLLLAGSCLPSPGITGLSHGSNREDR
Primary Structure
Compute pI
Theoretical pI 4.45
Molecular weight 6256.23 (Daltons)
Protparam
Formula C276H443N73O84S4
Sequence Length 58
Total Atoms 880
Secondary Structure
GOR, HNN & SOPMA
Tertiary Structure Prediction
I-TASSER
3-D Structure predicted By I-tasser server(Ab initio method) = Q9BZ97
-----The estimate of Q9BZ97-----------
#model : C-score TM-score RMSD (in Angstroms)
Q9BZ97 : -1.99 0.48 +- 0.15 6.9 +- 4.1
C-score is a confidence score of the I-TASSER predictions which is typically in [-5,2]. TM-score and RMSD measure how close the model is to the native structure and both are estimated based on the C-score. TM-score is in [0,1] with a value >0.5 implying the model of correct topology. The TM-score and RMSD estimations are made only for the first model because absolute values of TM-score and RMSD for the lower-rank models do not strongly correlate with the C-score. The models are ranked based on the structure density of I-TASSER simulations. Please cite following articles when you use the I-TASSER server:
1) Yang Zhang. I-TASSER server for protein 3D structure prediction.
BMC Bioinformatics, 9:40 (2008).
2) Yang Zhang. Template-based modeling and free modeling by
I-TASSER in CASP7. Proteins, 8: 108-117 (2007).
3) Sitao Wu, Jeffrey Skolnick, Yang Zhang. Ab initio modeling of
small proteins by iterative TASSER simulations. BMC Biology,
5:17 (2007).
Structure Validation
PROCHECK
Saves Result :Procheck Summary Ramachandran Plot: Plot Statistics