Q9BZA4

Homosapiens Y Chromosome Protein


 

Protein Sequence

>Q9BZA4|CY15B_HUMAN Uncharacterized protein CYorf15B - Homo sapiens (Human)

MKQEEAQLKEQLFLYMDKFEEFQTTMAKTNELFTAFKQETEKLTKKIKKLEKEMVIWYTK

WENNNTTLLQMAEEKTIRDKNYKVFQIKLERLEKLYKALQIERNELSEKLGILKGQVSVK

VADVDLAVPVTHSCADLDSSNMLNTSSKRAPGVHLEADPKGMNEVKCYSKALSTGSPLGI

D

Primary Structure

Compute pI

              Theoretical pI        7.67

              Molecular weight     20858.10 (Daltons)

Protparam 

              Formula                 C926H1502N242O284S9

              Sequence Length    181

              Total Atoms            2963

Secondary Structure

 GOR, HNN & SOPMA

GOR

HNN

SOPMA

Alpha Helix

Extended Strand

Random Coil

Alpha Helix

Extended Strand

Random Coil

Alpha Helix

Extended Strand

Beta Turn

Random Coil

50.83
17.13
32.04
51.38
14.36
34.25
68.51
3.31
1.10
27.07

Tertiary Structure Prediction

I-TASSER 

3-D Structure predicted By I-tasser server(Ab initio method) = Q9BZA4

-----The estimate of Q9BZA4 -----------
 #model    :   C-score     TM-score          RMSD (in Angstroms)
Q9BZA4 :   -2.39        0.43 +- 0.14   10.5 +- 4.6

      C-score is a confidence score of the I-TASSER predictions which is typically in [-5,2]. TM-score and RMSD measure how close the model is to the native structure and both are estimated based on the C-score. TM-score is in [0,1] with a value >0.5 implying the model of correct topology. The TM-score and RMSD estimations are made only for the first model because absolute values of TM-score and RMSD for the lower-rank models do not strongly correlate with the C-score. The models are ranked based on the structure density of I-TASSER simulations. Please cite following articles when you use the I-TASSER server:

  1) Yang Zhang. I-TASSER server for protein 3D structure prediction.
   BMC Bioinformatics, 9:40 (2008).
  2) Yang Zhang. Template-based modeling and free modeling by
   I-TASSER in CASP7. Proteins, 8: 108-117 (2007).
  3) Sitao Wu, Jeffrey Skolnick, Yang Zhang. Ab initio modeling of
   small proteins by iterative TASSER simulations. BMC Biology,
   5:17 (2007).

Structure Validation

PROCHECK

           Saves Result : Procheck Summary                                      Ramachandran Plot: Plot Statistics

Function Prediction

Interproscan

GOG

Pfam

Blast

Unintegrated
No relative Cog
Laminin Domain II No putative Conserved domains have been detected

                     Home