q9h8q0-2

Q9H8Q0-2

Homosapiens Y Chromosome Protein

Protein Sequence

>Q9H8Q0-2|CXY02_HUMAN Isoform 2 of Q9H8Q0 - Homo sapiens (Human)

MASHGGNTLEIVQKMGRCRLECGEGLRPCLVDGTVTAAVCLLGGASPPAAGRPLRETAES

WSPGQPGGDPSAGHRGHSRQQELRTLSATLLSNLWTLSSGQSCRIRHRTYSSALGRGSLK

KSPGLKTKRDTSVRYGRSSPPRTDPGTATRILNQGQRRGVWAGMGLPEVHPRGDLNRAP

Primary Structure

Compute pI

Theoretical pI 10.96

Molecular weight 19026.54 (Daltons)

Protparam

Formula C₈₀₅H₁₃₂₇N₂₇₁O₂₄₈S₈

Sequence Length 179

Total Atoms 2659

_{Secondary Structure}

_{GOR, HNN & SOPMA}

_{Tertiary Structure Prediction}

I-TASSER

3-D Structure predicted By I-tasser server(Ab initio method) = Q9H8Q0-2

-----The estimate of Q9H8Q0-2-----------

#model : C-score TM-score RMSD (in Angstroms)

Q9H8Q0-2: -3.79 0.30 +- 0.10 14.1 +- 3.8

C-score is a confidence score of the I-TASSER predictions which is typically in [-5,2]. TM-score and RMSD measure how close the model is to the native structure and both are estimated based on the C-score. TM-score is in [0,1] with a value >0.5 implying the model of correct topology. The TM-score and RMSD estimations are made only for the first model because absolute values of TM-score and RMSD for the lower-rank models do not strongly correlate with the C-score. The models are ranked based on the structure density of I-TASSER simulations. Please cite following articles when you use the I-TASSER server:

1) Yang Zhang. I-TASSER server for protein 3D structure prediction.

BMC Bioinformatics, 9:40 (2008).

2) Yang Zhang. Template-based modeling and free modeling by

I-TASSER in CASP7. Proteins, 8: 108-117 (2007).

3) Sitao Wu, Jeffrey Skolnick, Yang Zhang. Ab initio modeling of

small proteins by iterative TASSER simulations. BMC Biology,

5:17 (2007).

Structure Validation

PROCHECK

Saves Result : Procheck Summary Ramachandran Plot: Plot Statistics

Function Prediction

Home