Q59GH2

Homosapiens Y Chromosome Protein


 

Protein Sequence

>Q59GH2|Q59GH2_HUMAN NY-REN-8 antigen variant - Homo sapiens (Human)

PPLGASVLWENVSKLWSCLFSSPVWTPRPSCKHRSRAARFGEKARPPRSSVCSSRPGLRP

VLGGFSPAPQAPPPGAFVEPASSARSALLAQRLELKVGSGDCLVLEVGGRAACVSRKTAQ

GLLRAAGHVFAIPSLQVRGRAQPRGAEAECAALPAGPEALLRGALTAGRRGPVRVRVRGR

GPGAAVTPPARTPPRGRPPRATTGPPRLV

Primary Structure

Compute pI

              Theoretical pI        11.88

              Molecular weight     21720.23 (Daltons)

Protparam 

              Formula                 C953H1569N311O259S6

              Sequence Length    209

              Total Atoms           3098

Secondary Structure

 GOR, HNN & SOPMA

GOR

HNN

SOPMA

Alpha Helix

Extended Strand

Random Coil

Alpha Helix

Extended Strand

Random Coil

Alpha Helix

Extended Strand

Beta Turn

Random Coil

22.97
11.48
65.55
31.58
7.18
61.24
27.75
16.27
5.74
50.24

Tertiary Structure Prediction

I-TASSER 

3-D Structure predicted By I-tasser server(Ab initio method) = Q59GH2


-----The estimate of Q59GH2 -----------
 #model  :  C-score   TM-score          RMSD (in Angstroms)
 A2RUG3 :  -3.45     0.33 +- 0.11    13.6 +- 4.0     

      C-score is a confidence score of the I-TASSER predictions which is typically in [-5,2]. TM-score and RMSD measure how close the model is to the native structure and both are estimated based on the C-score. TM-score is in [0,1] with a value >0.5 implying the model of correct topology. The TM-score and RMSD estimations are made only for the first model because absolute values of TM-score and RMSD for the lower-rank models do not strongly correlate with the C-score. The models are ranked based on the structure density of I-TASSER simulations. Please cite following articles when you use the I-TASSER server:

  1) Yang Zhang. I-TASSER server for protein 3D structure prediction.
   BMC Bioinformatics, 9:40 (2008).
  2) Yang Zhang. Template-based modeling and free modeling by
   I-TASSER in CASP7. Proteins, 8: 108-117 (2007).
  3) Sitao Wu, Jeffrey Skolnick, Yang Zhang. Ab initio modeling of
   small proteins by iterative TASSER simulations. BMC Biology,
   5:17 (2007).

Structure Validation

PROCHECK

           Saves Result : Procheck Summary                                       Ramachandran Plot: Plot Statistics

Function Prediction

Interproscan

GOG

Pfam

Blast

HMG-I and HMG-Y, DNA-binding No related Cog GUN4-like No putative conserved domains have been detected

                     Home