A6NDE4

Homosapiens Y Chromosome Protein


 

Protein Sequence

>A6NDE4|RBY1B_HUMAN RNA-binding motif protein, Y chromosome, family 1 member B - Homo sapiens (Human)

MVEADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTSKSRGFAFITFENPAD

AKNAAKDMNGKSLHGKAIKVEQAKKPSFQSGGRRRPPASSRNRSPSGSLRSARGSRGGTR

GWLPSQEGHLDDGGYTPDLKMSYSRGLIPVKRGPSSRSGGPPPKKSAPSAVARSNSWMGS

QGPMSQRRENYGVPPRRATISSWRNDRMSTRHDGYATNDGNHPSCQETRDYAPPSRGYAY

RDNGHSNRDEHSSRGYRNHRSSRETRDYAPPSRGHAYRDYGHSRRDESYSRGYRNRRSSR

ETREYAPPSRGHGYRDYGHSRRHESYSRGYRNHPSSRETRDYAPPHRDYAYRDYGHSSWD

EHSSRGYSYHDGYGEALGRDHSEHLSGSSYRDALQRYGTSHGAPPARGPRMSYGGSTCHA

YSNTRDRYGRSWESYSSCGDFHYCDREHVCRKDQRNPPSLGRVLPDPREAYGSSSYVASI

VDGGESRSEKGDSSRY

Primary Structure

Compute pI

           Theoretical pI         9.96 

          Molecular weight      55834.60(Daltons)

Protparam 

            Formula                  C2369H3634N800O756S13

            Sequence Length    496

            Total Atoms           7572

Secondary Structure

 GOR, HNN & SOPMA

GOR

HNN

SOPMA

Alpha Helix

Extended Strand

Random Coil

Alpha Helix

Extended Strand

Random Coil

Alpha Helix

Extended Strand

Beta Turn

Random Coil

6.45
15.93
77.62
7.66
7.26
85.08
7.26
10.48
6.85
75.40

Tertiary Structure Prediction

I-TASSER 

3-D Structure predicted By I-tasser server(Ab initio method) = A6NDE4

-----The estimate of A6NDE4 -----------
 #model    : C-score   TM-score      RMSD (in Angstroms)
A6NDE4 : -1.38      0.54+-0.15   10.5+-4.6 

      C-score is a confidence score of the I-TASSER predictions which is typically in [-5,2]. TM-score and RMSD measure how close the model is to the native structure and both are estimated based on the C-score. TM-score is in [0,1] with a value >0.5 implying the model of correct topology. The TM-score and RMSD estimations are made only for the first model because absolute values of TM-score and RMSD for the lower-rank models do not strongly correlate with the C-score. The models are ranked based on the structure density of I-TASSER simulations. Please cite following articles when you use the I-TASSER server:

  1) Yang Zhang. I-TASSER server for protein 3D structure prediction.
   BMC Bioinformatics, 9:40 (2008).
  2) Yang Zhang. Template-based modeling and free modeling by
   I-TASSER in CASP7. Proteins, 8: 108-117 (2007).
  3) Sitao Wu, Jeffrey Skolnick, Yang Zhang. Ab initio modeling of
   small proteins by iterative TASSER simulations. BMC Biology,
   5:17 (2007).

Structure Validation

PROCHECK

           Saves Result : Procheck summary                                           Ramachandran Plot: Plot statistics

Function Prediction

Interproscan

GOG

Pfam

Blast

RNA recognition motif, RNP-1, RBM1CTR, Nucleotide-binding, alpha-beta plait, Y chromosome RNA recognition motif RNA-binding proteins (RRM domain) RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), RBM1CTR (NUC064) family, NF-X1 type zinc finger, Sulfakinin family, Follistatin RRM, RNA recognition motif; ,RBM1CTR (NUC064) family

                     Home