Q99218-2

Homosapiens Y Chromosome Protein


 

Protein Sequence

>Q99218-2|AMELY_HUMAN Isoform 2 of Q99218 - Homo sapiens (Human)

MGTWILFACLVGAAFAMPLPPHPGHPGYINFSYENSHSQAINVDRIALVLTPLKWYQSMI

RPPYSSYGYEPMGGWLHHQIIPVVSQQHPLTHTLQSHHHIPVVPAQQPRVRQQALMPVPG

QQSMTPTQHHQPNLPLPAQQPFQPQPVQPQPHQPMQPQPPVQPMQPLLPQPPLPPMFPLR

PLPPILPDLHLEAWPATDKTKQEEVD

Primary Structure

Compute pI 

Theoretical pI         6.92
 
Molecular weight    23249.93 (Daltons)  

Protparam    

              Formula                       C1067H1617N287O279S10      

              Sequence Length      206

          Total Atoms            3260

Secondary Structure         

GOR, HNN & SOPMA  

GOR

HNN

SOPMA

Alpha Helix

Extended Strand

Random Coil

Alpha Helix

Extended Strand

Random Coil

Alpha Helix

Extended Strand

Beta Turn

Random Coil

10.19
16.50
73.30
16.02
5.83
78.16
15.53
6.80
2.43
75.24

Tertiary Structure Prediction

I-TASSER 

3-D Structure predicted By I-tasser server(Ab initio method) = Q99218-2

-----The estimate of Q99218-2-----------

 #model    :  C-score     TM-score          RMSD (in Angstroms)
 Q99218-2 :  -2.86       0.39 +- 0.13    12.0 +- 4.4

      C-score is a confidence score of the I-TASSER predictions which is typically in [-5,2]. TM-score and RMSD measure how close the model is to the native structure and both are estimated based on the C-score. TM-score is in [0,1] with a value >0.5 implying the model of correct topology. The TM-score and RMSD estimations are made only for the first model because absolute values of TM-score and RMSD for the lower-rank models do not strongly correlate with the C-score. The models are ranked based on the structure density of I-TASSER simulations. Please cite following articles when you use the I-TASSER server:

  1) Yang Zhang. I-TASSER server for protein 3D structure prediction.
   BMC Bioinformatics, 9:40 (2008).
  2) Yang Zhang. Template-based modeling and free modeling by
   I-TASSER in CASP7. Proteins, 8: 108-117 (2007).
  3) Sitao Wu, Jeffrey Skolnick, Yang Zhang. Ab initio modeling of
   small proteins by iterative TASSER simulations. BMC Biology,
   5:17 (2007).

Structure Validation

PROCHECK   

           Saves Result : Procheck Summary                                               Ramachandran Plot: Plot statistics

Function Prediction


Interproscan

COG

Pfam

Blast

Amelogenin

No related Cog

Amelogenin

Amelogenin superfamily

                     Home