Q658T2

Homosapiens Y Chromosome Protein


 
Protein Sequence

>Q658T2|Q658T2_HUMAN Putative uncharacterized protein DKFZp666C074 - Homo sapiens (Human)

MIFLSNFKKWFTIFFFFCHLSFQAFPAYPNSAVQVTTGYQFHVYNYQMPPQCPVGEQRRH

ILLIQIHQVRSPLGVSCLYVIIRNLWTEAYKWWYLVCLIQRRD

Primary Structure

Compute pI

          Theoretical pI         9.42

           Molecular weigh     12499.68 (Daltons)

Protparam

         Formula                 C593H867N149O139S6 

           Sequence Length    103 

           Total Atoms           1754

Secondary Structure

 GOR, HNN & SOPMA

GOR

HNN

SOPMA

Alpha Helix

Extended Strand

Random Coil

Alpha Helix

Extended Strand

Random Coil

Alpha Helix

Extended Strand

Beta Turn

Random Coil

11.65
36.89
51.46
38.83
27.18
33.98
24.27
37.86
7.77
30.10

Tertiary Structure Prediction

I-TASSER 

3-D Structure predicted By I-tasser server(Ab initio method) = Q658T2

-----The estimate of Q658T2-----------

 #model  :   C-score    TM-score           RMSD (in Angstroms)
 Q658T2 :   -3.24       0.35 +- 0.12    11.2 +- 4.6

      C-score is a confidence score of the I-TASSER predictions which is typically in [-5,2]. TM-score and RMSD measure how close the model is to the native structure and both are estimated based on the C-score. TM-score is in [0,1] with a value >0.5 implying the model of correct topology. The TM-score and RMSD estimations are made only for the first model because absolute values of TM-score and RMSD for the lower-rank models do not strongly correlate with the C-score. The models are ranked based on the structure density of I-TASSER simulations. Please cite following articles when you use the I-TASSER server:

  1) Yang Zhang. I-TASSER server for protein 3D structure prediction.
   BMC Bioinformatics, 9:40 (2008).
  2) Yang Zhang. Template-based modeling and free modeling by
   I-TASSER in CASP7. Proteins, 8: 108-117 (2007).
  3) Sitao Wu, Jeffrey Skolnick, Yang Zhang. Ab initio modeling of
   small proteins by iterative TASSER simulations. BMC Biology,
   5:17 (2007).

Structure Validation

PROCHECK

           Saves Result : Procheck Summary                                      Ramachandran Plot: Plot Statistics

Function Prediction

Interproscan

COG

Pfam

Blast

Unintegrated
No relative Cog
S locus-related glycoprotein 1 binding pollen coat protein (SLR1-BP) No hits

                     Home