
För att söka författare eller böcker , tryck Ctrl och F och fyll i sökfältet ! 
 Beställningar , förfrågningar skickas till

REA-böcker i lager.              1 € / st.        Böckerna är i normalt skick. 


               Uppdaterad 23.05.2017                       

                                                        Åländska REA-böcker , se längst ner : ALANDICA

 Var god uppge katalognummer vid beställning !

32512 Harry Blomberg : Hon hette Eva.    1952 pb 286 s.

32514 Lars Göransson : Nu skriar påfågeln.    1974 poc 245 s.

32518 Jan Fridegård : Offerrök.     1967 poc 147 s.

325182 Jan Fridegård: Trägudars land.  1964 poc 158 s.

32521 George Carpozi,Jr : John Lennon – death of a dream.        Ill.1980 poc 254 s.

32528 Lars Bjurman  : Modern engelsk berättarkonst.13 olika förf. 1966 poc 207 s.

32530 Jan Fridegård : En natt i juli.     1978 poc 140 s.

32543 Gustav Sandgren : Ett fönster mot söder.   1951 hft 253 s.

32547 Klas Östergren : Handelsmän och partisaner.   1992 poc 255 s.

32551 Peter Freuchen : Nordkaparen.        Ryggskada.  1948 pb 250 s.

32554 Inga Nalbandian : Barndom. En bok om barn.  1919 hft 181 s.

32561 Hans Helmut Kirst : 0/8-15 i fält.   Om korpral Asch.  1983 poc 320 s.

32563 Sven Rosendahl : Räven från Krackberget.   1949 pb 195 s.

32566 Elisabeth Bergstrand-Poulsen : Lovsång till träorkester. 1935 hft 62 s.

32569 Elisabeth Kuylenstierna-Wenster : För länge sedan. Roman. 1927 klb 303 s.

32571 Robert Harris : Faderland. Det är 1964 och Hitler vann kriget ......1994 poc 342 s.

32572 Ronald W Clark : Berättelser om flykt till verkligheten.  1958 pb 145 s.

33501 Yngve Berg : Robin Hood.             Med  eng. meningar. 1961 pb 140 s.

33518 P Nordmann : Björnstjerne Björnson. I lif och lära. Ill. 1916 hft 163 s.

33520 Walter Scott  : Ivanhoe I – II.  Med  eng. meningar.1957 pb 140 + 140 s. Tills. 2 e.

33530 Budd Schulberg : Storstadshamn.      Fr New Yorks hamn. 1956 poc 341 s.

33535 Harry Martinson : Elin Wägner. Inträdestal till Sv. Akademien.1949 hft 21 s.

33544 Sigfrid Siewertz : Minnets kapriser.  Noveller.   1963 hft 232 s.

33552 Barbara Taylor Bradford : Inte för vinnings skull. TV-serie. 1986 poc 452 s.

33558 Erik Jannersten : Frågor och svar I.  Bridge för nybörjare.  Rikl.ill. 1974hft 144 s.

33560 John le Carre : Spionen måste dö.    1961 poc 183 s.

33569 Anneli Rogeman : 100 frågor om att vänta barn. Rikl.ill. 1990 hft 94 s.

33570 Upton Sinclair : Olja.  Roman.     1950 pb 294 s.

33580 N Hyden : Den modige Skeppsholmsprästen. Eric Tolstadius´liv. Ill.1940 hft 92 s.

34503 Arthur Hailey : Krisen.     Fr. Kalifornien.   1980 poc 351 s.

34505 Ernst Didring : Malm. Männen som gjorde det. Fr. Norrland.1994 poc 188 s.

34510 Bertel Klinkman : Pälsriket.            Debattbok.  1986 hft 62 s.

34512 Svetlana Allilujeva : Tjugo brev till en vän.   Stalins dotter. 1967 hft 239 s.

34514 Gerald Verner : Drama i Hollywood.    Deckare.  1946 hft 228 s.

34518 Knud Lundberg : Vi laver sund mad.     Dansk.   Rikl.ill. 1971 klb 256 s.

34520 Lorentz Bolin : Strövtåg i skog och mark.  Handledning.  Ill. 1946 hft 104 s.

34525 Laszlo Nemeth : Den ensamma.   Ungersk.   1971 inb 248 s.Op

34527 Ragnar Wirsen : Manfred Perssons underbara resa.  Hjältedikt.1954 hft 62 s.

34528 Craig Rice : Rätt i rövarhänder.    1964 poc 262 s.

34530 Göran von Bonsdorff : Våra politiska partier.   1951 hft 94 s.

34534 Yasar Kemal : Jord av järn himmel av koppar.  1975 poc 242 s.

34538 Sir Gilbert Parker : Vildmarkens vagabond.   1911 pb 138 s.

34548 Irma St Cyr : Hjalmar Bergman privat.Familjebilder o miljö.1973 poc 142 s.

34549 Collins & Lapierre:Den femte ryttaren.USA skall tvinga Israel till reträtt ...1984    poc 507 s.

34550 Riksförb. för hembygdsvård : Stadsborna. Stadsstudier.  Ill. 1981 hft 103 s.

34551 Alistair Maclean : Styrka 10 från Navarone.   U. II vrk. 1974 poc 288 s.

34557 Bengt Söderbergh : De gåtfulla barrikaderna.   1984 poc 310 s.

34560 Birgitte Båstad : Dorte detektiv avslöjar smugglarna.  1958 pb 115 s.

34562 Karl Erik Larsson : En hövdings stol.  Fr. Angola.Rikl.ill.  u å  hft 29 s.+karta

34563 Kjell E Genberg : Jagad av indianer.    Polka-bok.  1975 pb 155 s.

34565 C G Bjurström (urv) : Fransk berättarkonst.   19 olika förf. 1963 poc 228 s.

34567 Richard Crompton : Bill spelar TV-teater.   1961 pb 136 s.

34568 Fredrik Ekelund : Taxi sju-två. Bland drömmare och dårar. 1998 poc 257 s.

34571 Ströyers dagbok 1987.    Rikl.ill. 1987 kart 110 s.

34575 Gunvor Gränström : Pyttan i Sydamerika.   1949 pb 142 s.

34576 Amnestyrapport om politiska fångar i Sovjet.    1975 poc 213 s.

34578 Honore de Balzac : Noveller. En episod under skräckväldet. 1961 pb 202 s.

34579 Göran Hägg : Money,money,money.    1994 poc 425 s.

36503 Gabriel Garcia Marques : Hundra år av ensamhet.    1988 poc 360 s.

36506 Karl-Erik Forsslund : Djur. Historier fr. Storgården.   1926 pb 207 s.

36511 Magnus Gustafsson : Mikrober,miljö och samhälle.   1971 poc 191 s.

36515 Trafiksäkerhetsverket : Bil &trafikboken.  Rikl.ill.   1985 poc 205 s.

36516 Esaias Tegner : Fritiofs saga.      1956 hft 120 s.

36522 Lennart Rudström : Lillo och hunden.          Med bilder.   1965 pb 40 s.B

36524 Maud Hägg & Barbro Werkmäster : Frihet-jämlikhet-systerskap.       Ill. 1978 poc 132 s.

36527 Eric Leijonancker : Nobelpristagaren på fattighuset.Om Henri Dunant. 1945 hft 151 s.

36529 Lorentz Bolin : Vackert och fult i det svenska landskapet.   Ill.  1947 hft 102 s.

36538 Kai Berg Madsen(urv) : Sådan är kärleken Madame.       Citat. 1946 inb 185 s.Op

36540 Antonio : Vad livet gav I.                       Dikter.    1942 klb  142 s.

36541 N Lalander: Socialism med mänskligt ansikte: Dok. fr. Tjeckoslovakien 1968 poc 159 s.B

36547 Märtha Nickul : Altarlågan.  Fragment ur livsöden.   1965 hft 143 s.

36548 Laxdölasagan.  Urv.: N Beckman.     1961 sft 62 s.

36557 Yasar Kemal : Och de brände tistlarna.     1976 poc 503 s.

36565 Sven Swensson : Masaryk-folkhjälten.     1947 pb 144 s.

36569 Lojosamfundet : Festskrift till Margit Karsten.           Ill.   1973 hft 65 s.

36572 Per Anger : Med Raoul Wallenberg i Budapest. Fr. kriget. Understreckn. 1985 poc 185 s.

36573 Svenska turistföreningen : Årsskrift 1955.   Många artiklar.Rikl.ill. 1955 hft 324 s.

36574 Gunnar Mattsson : Prinsessan.      1966 pb 166 s.B

36576 Ronald Segal : Amerika – vision eller verklighet.   1969 poc 337 s.B

37502  Ole Hessler : Rörelser hos den andra kroppen.  Dikter.    1979 hft 80 s.

37504  Svensk botanisk tidskrift nr 2-2000 bla : Hammarsjön,Skåne,Flora Nordica.          hft 60 s.

37505  När – Var – Hur 1971.  Rikl.ill. årsbok.     1970 kart 480 s.

36513 Bonniers folkbibliotek : Världsatlas.     1955 pb 205 s.

36516 Uno Axelsson : Sol över djungeln.  Fr Indien.   1957 inb 180 s.Op

37517 Rachel L Carson : Havet.         Världsberömd bok.    1964 poc 218 s.

37524 Gun Jörge : Måla och reparera själv.     Ill.    1956 pb 87 s.

37526 Björn-Erik Höijer  : Martin går i gräset.  Fr. lappländskt gruvliv.  1966 poc 211 s.

37528 Spanska semestermål : Mallorca.Stadsplan öv. Palma de Mallorca med 28 sevärdh..1989

37530 Jenny Berthelius : Den heta sommaren.  Prisbelönad kriminalroman. 1985 poc 158 s.

37535 Marie-Anne Bergman-Larby : Men ändå lycklig. Tankar fr. sjukrum.1957 inb 128 s.Op

37537 Art suedois contemporain 1900-64.Collection de l ínstitut Tessin. Ill. 1964 hft 96 s.

37538 Bo Ancker : Bortom stadens yttersta staket.    Fr. Stockholm.  1965 hft 48 s.

37541 Carl Snoilsky : Svenska bilder.   Dikter.           Blad 21/22 saknas. 1904 dekklb 235 s.

375412 Carl Snoilsky : Svenska bilder. Dikter.        1951 hft 160 s.

37546 Barbara von Schoultz : Den älskades tand.    1965 hft 51 s.

37548 Rolf Krogerius m.fl. : Hälsolära.           Ill.    1938 pb 188 s.

37549 Svenska turistföreningen : Vandrarhem och fjäll 1999. Fr. hela Sverige. Ill.1999 hft 284 s.

37550 Michael Collins : Tigerns skugga.                  Bra böckers deckare. 1974 inb 204 s.Op

37551 Sven B Ek : Döden i Lund.                                    -  ”  -  ”  - 1976 inb 189 s.Op

37552 Elisabeth Lemarchand : Sekvens i livstid.        -  ”  -  ”  -  1975 inb 241 s.Op

37554 Lavyrle Spencer : Ett löfte om kärlek.    1997 inb 316 s.Op

37559 Ulrik Fagerholm : Destillat 112.        Dikter.    1990 hft 61 s.

37560 B E Olson:Driven av kärlek.  Bl. motilonindianerna i Colombia. Ill.1977 inb 189 s.Op

37564 Axel Burman : Bland afrikanska fångar.      1963 pb 103 s.

37565 Iwan Bolin : Kemien och vad den lär oss i det praktiska livet.  Ill.  1931 hft 234 s.

37569 Jan Carle : Iakttagelser.      Illustr. aforismer .    1984 pb 95 s.B

37571 Jan Tschechold : Hvad enhver bör vide om bogtryk.  Ill. Dansk.  1952 pb 68 s.

37572 Folke Mellvig : Dödens mannekänger.     1968 poc 159 s.

37573 Musee Bernadotte a´Pau : La vie de Jean-Baptiste Bernadotte.Bildalb. 1966 hft 72 s.

37575 Mathilda Malling : Nina.      Ill.      1903 hft 106 s.

37578 August Blanche : Vålnaden I.  Roman. Pärm : Jenny Nyström.  1913 hft 192 s.

37579 John Finnemore : Det heliga landet.    Med 12 akvarellplanscher.  1912 pb 99 s.

38501 D K Burnham : Skjortor,särkar och blusar.   Modern handbok. Ill.  1979 kart 80 s.

38502 Erskine Caldwell : Sydstatsnoveller.     1962 poc 136 s.

38504 Howard Norton : Jimmy Carter-hans väg mot toppen.     Ill.  1976 poc 132 s.

38505 The Museum of London.   Rikl.ill. guide.    1980 spiral 24 s.

38506 Vårt kungapar. Året som gått med den kungliga familjen. Rikl.ill.   1991 hft 64 s.

38508 Alistair MacClean : Örnnästet.   Gestaponäste intas.   1974 poc 252 s.

38509 Stefan Daagarsson : Korsbärarna.       Roman. Förf. ded.  1977 hft 88 s.

38518 Trafiksäkerhetsverket : Bil- & trafikboken.        Rikl.ill.   1985 hft 207 s.

38525 Rudolv Körner : Levande lyrik.  Svenska o författare.  1956 hft 139 s.

38527 A K Ottelin : Herbartiansk historieundervisning.Akad. avhandling vid HU. 1908 hft 115 s.

38531 Libraria kyrklig konst.Prov på dess tillverkning o strävan till förädlad vara.1938 sft 30 s.ill

38536 Gerald Browne : Dödens smaragder.  Agentroman fr. Sydamerika. 1980 inb 364 s.Op

38539 Perri Klass : Älskandes kemi.     1987 inb 331 s.Op

38545 Sören Lindgren : De tolv.   Dikter.     1957 hft 58 s.

37548 Carita Englund : En dörr på glänt.  Dikter.   Förf.ded. 1989 hft 65 s.

38549 Anna Wahlgren : Rosengården.     1987 inb 258 s.Op

38553 Blom:Flere olycklige uslingar utgå friske och helbregde därifrån.Vård i Karlstad u 200 år.-75 sft 64 s.

38554 Jonellen Heckler : Bräcklig lycka.    1989 inb 248 s.Op

38555 Osm A Wiio:Readability,comprehension and readership.Finl.Magaz. articl.1968 hft 161 s.

38556 E Wasström:Från sandbänk till typalfabet. Skrivundervisn. i Finl.1940 sft 10 s.  Förf. ded.

38560 Rona Jaffe : Efter klassträffen.     1987 inb 298 s.Op

38564 Ragn. Nummelin:Intertribal relations in central and south Africa.Förf.ded. 1963 hft 114 s.

38568 M Blåfield : Johan Eriksson Norberg 1660-1740. Nordenskiöld-ättens stamfader.1995 sft 32 s.   Ill.

38569 Oscar Nikula : Teaterliv i Åbo.   Fr. 125-års festen.   1965 hft 18 s. 

38571 Levi Ulfvens : Elin och Karl Pentzin –donatorer och kulturfrämjare. Ill. 1997 hft 128 s.

38572 Robert Bloch : Psycho II.   Filmad rysare.    1984 pb 240 s.B

38574 Desmond Bagley : Lindansarna.      1974 poc 258 s.

38576 Carl Michael Bellman i urval av Björn Julen.       1962 poc 112 s.

38577 Michael H Day : Människans förfäder.             Rikl. färgill.  1970 poc 160 s.

40507 George Vandeman : Hur länge vill du leva ?    1973 hft 118 s.

40512 Aila Meriluoto : Peter-Peter.     En kärlekshistoria.   1972 hft 199 s.

40520 Robert Louis Stevenson : Kipnapped.   På engelska. 1994 inb 380 s.Op

40525 Fredrik Holm & Bo Thunberg : Det miljövänliga kontoret. Rikl.ill. 1991 hft 112 s.

40527 Lena Levine & David Loth : Samliv utan kyla. Frigiditetens problem. 1965 poc 183 s.

40529 Nils Kalen : Vettig föda.  Ill.      1974 hft 95 s.

40531 Johannes Linnankoski : Den eviga striden.   Skådespel.   1904 hft 202 s.

40534 Erik Ewalds : Brinna – inte slockna.Engagemang och utbrändhet. Understr.1989 sft 89 s.

40539 Christian Braw : I tiden. Essayer och samtal.        Understreckn. 1995 inb 156 s.Op

40544 Sjöbjörnen nr 2 / 1993.       Olika artiklar.   Ill.            sft 64 s.

40545 Hermann Sudermann : Åtrå.        Roman.    1928 hlvfr 416 s.

40546 Kurtzer Fuhrer : Die staatliche Eremitage.  Guide ill. i sv.v.  1955 hft 180 s.

40547 Marianne Rath : Caro & co.          Flickbok.    1946 pb 148 s.

40548 Per Wästberg : Jordmånen.   Betydelsefull roman.    1973 poc 373 s.

40550 Zadie Smith : Vita tänder.      2001 poc 476 s.

40553 Elisabet Hermodsson (red) : Kvinnors dikt om kärlek.   1979 poc 224 s.

40554 J Th Jacobsson :Ur lifvets skola.Dikter och sånger. Mkt vacker djupblå pärm.1902 dekklb 264 s.

40561 P Nordmann : Björnstjerne Björnson. I lif och lära. Nobelpris 1903.  Ill. 1916 hft 163 s.

40565 Per Meurling : Shakespeare.  Biografi.   Ill.    1964 poc 255 s.

40566 G A Gripenberg : Neutralitetstanken i Finlands politik.  Bla vsb-pakten. 1960 sft 59 s.

40567 Harry Bloom : Det hände i Transvaal.  Fr. Sydafrika.   1967 hft 329 s.

40570 Catherine Cookson : Tilly Trotter.    1982 inb 312 s.Op

40574 Wole Soyinka : Laglöshetens tid.                    Nobelpris 1986.  1983 poc 318 s.

40578 Caroline Lewenhaupt : Levnadsvishet.    1943 inb 274 s.Op

40579 Alan Paton : Hymn till en älskad.    Memoarbok.   1970 inb 146 s.Op

41502 H.-K. Rönblom : Mannen som höll sig undan.    1964 hft 217 s.

41503 Nationalmuseum bulletin Vol. 8 ,nr 1.   Rikl.ill.    1984 hft 44 s.

41504 Föreningen Nationalmusei vänner:Kontakt med Nationalmuseum. Med medl. förteckn.1976 hft 60 s.

41505 Kjell-Olof Bornemark : Legat till en trolös.  Debutdeckare.  1991 poc 229 s.

41506 Hellmark m. fl.:Ni har väl läst tidningen idag ? Kritisk analys.  1969 hft 160 s.

41508 Sofokles : Kung Oidipus.       1964 sft 56 s.

41513 Mark Derby : Högt spel i Malacka.       1953 pb 255 s.

41514 Leslie Carteris : Helgonet i Europa.     1964 poc 198 s.

41518 J L Runeberg : Kung Fjalar.  Dikt i fem sånger.    1956 hft 80 s.

41520 Jon Cleary : Modets källa.      1957 pb 320 s.

41529 Ross MacDonald : Bytet.       1967 poc 229 s.

41530 Sjöbjörnen nr 2 /1992.  Ill.             sft 32 s.

41531 P G Wodehouse : Sam hos tidningskungen.    1944 hft 223 s.

41533 Ulf Durling : Säg PIP. Detektivroman i Ess-dur.    1975 hft 294 s.

41537 Katherine Mansfield : Smekmånad och andra berättelser.   1978 klb 256 s.

41538 Årets rysare 6 . 14 chocknoveller bla A Christie,Vic Suneson.  1977 hft 142 s.

41540 In the heart of Germany-in the twentieth century.   Rikl.ill. taggtråd o murar.1960 sft 48 s.

41541 Helen Nielsen : En hårsmån från mord.     1979 klb 263 s.

41542 Tor Hedberg : Anders Zorn – en studie. Ill.    1906 hft 31 s.

41543 Einar Wallqvist : Kan doktorn komma ? Fr. Lappmarken. Ill. 1937 dekklb 160 s.

41544 Kenneth Gandar Dower : Det fläckiga lejonet. Vildmarks- o jakthistoria.Ill.1938 hft 272 s.

41548 Algot Anderberg : Medling i äktenskap.  Erfarenheter o synpunkter. 1950 hft 193 s.

41550 Vicki Baum : Skeppet och stranden.     1952 pb 256 s.

41551 Lindqvist & Dahlström:Hjälpreda vid den första behandlingen av husdjurens sjukdomar.1930 sft 98 s.

41552 C V Terry : Amiralens läkare.      1957 hft 290 s.

41557 Marianne Fredriksson : Simon och ekarna.    1990 poc 343 s.

41559 Gösta Hagelin (red) : Ord att tänka på.    Antologi.   1969 hft 158 s.

41560 Peter Hoeg : Kvinnan och apan.      1998 poc 244 s.

41563 Prosper Castanier : Jungfrun från Babylon.  Antik sederoman.  1902 pb 198 s.

41564 Carl Snoilsky : Svenska bilder.  Ill.     1937 pb 160 s.

41565 Erik Palm : Uppslagsbok för skrivbordet.     1957 pb 320 s.

41567 D B bokurv.233:Husvakten/FamiljenAlberti/Siste man ut/Observatoriet.2004 inb 515 s.Op

41568 Anja Porio : Lycka och välsignelse !  En bok på din högtidsdag. Ill. 1994 kart 53 s.

41570 Alphonse Walleen : Nu vina höstens vindar.   Dikter.   1930 hft 101 s.

41573 Gustaf Lundberg : Svarta penseer.      Dikter.    1922 hft 93 s.

41575 Marika Stiernstedt : Landshövdingens dotter.    1950 hft 190 s.

41578 Guy de Maupassant : Yvettes friare  o andra noveller.   1953 pb 255 s.

42503 Leslie Charteris : Helgonet i högform.     1964 hft 240 s.

42506 Lilian Björk-Hempel : Bra mat – bättre hälsa.  Liten näringslära.  Ill. 1958 hft 126 s.

42519 August Blanche : Flickan i stadsgården.  Berättelse.             1928 hlvfr 384 s.

42524 Agneta Pleijel : Vindspejare. Boken om Abel Målaren.   1989 poc 454 s.

42526 Bernhard v. Beskow : Minnesboken om Johan Olof Wallin.  1962 hft 58 s.

42527 Lovisa Petterkvist : Hemma i Jockmock.  Ur småstadslivet.         1913 dekklb 264 s.

42531 Per Anders Fogelström : Minns du den stad.  Del III i stad-serien.  1970 poc 316 s.

42532 B Olsson (red) : Folket i Norden berättar.  10 olika folklivsskildr.   Ill. 1973 hft 168 s.

42533 Bruno Cicognani : Jag,konungen.      1956 hft 165 s.

42534 Asta Östenius : Ris på många vis.  120 recept.  Ill.    1960 hft 77 s.

42540 Britt-Marie Andersson : Djupfrysning.  Den moderna handboken. Ill. 1967 hft 92 s.

42547 Gustaf af Geijerstam : Boken om Lille-bror.    1905 hft 166 s.

42549 Renata Wrede : Juvelskrinet.       1973 hft 105 s.

42550 Budd Schulberg : Storstadshamn.  Fr. New York.          1956 inb 341 s.Op

42553 Den levande antiken. Uppsatser om den klassiska litteraturen.  1973 poc 175 s.

42557 Runa : Trettonåringar / Bröllopet på Lönnvalla.   1960 inb 128+112 s.Op

42559 Neapel. Bildalbum med fyra språks bildtext. ”Dragspel”.     u å  pb 38 s.

42563 Sigfrid Siewertz : Hem från Babylon.    1943 inb 342 s.Op

42569 Karen Dissing Melega : Inte ett ord om Michelangelo.Det politiska Italien. 1971 poc 175 s.

42571 A J Carlyle : Den engelska kyrkan och kyrkans enhet.   1919 hft 100 s.

42574 Sigvard Mårtensson : Eugene O´Neills dramatik. Handbok.  Ill.  1957 hft 159 s.

42578 Lars Ahlin : Kvinna kvinna.      1957 inb 247 s.

42580 Fredrik Nycander (red) : Sankt Erikssagan.    1920 sft 24 s.

44503 Peter Gissy & Evert Lundström : Fru Margareta.   Fr. Sundsby gård.  Ill. 2000 hft 46 s.

44505 Fredrik Cederborgh : Uno von Trazenberg. Berättelse av friherre Dolk. 1928 hft 248 s.

44511 Elis Håstad : Sveriges historia under 1900-talet.    Rikl.ill.   1958 poc 168 s.

44515 M Beckman : fantasi-improvisation och rörelse. Gymnastik.Med skiva. 1970 kart 103 s.

44518 Sven Green : Blommorna i hemmet.     Rikl.ill.    1955 hft 88 s.

44522 A B Wilh. Becker : Tjugosex konstnärer om materialet.   Rikl.ill.  1939 sft 44 s.

44523 G Törnstrand : Våra vanliga metaller. Framställning o användning. Ill. 1927 hft 184 s.

44526 Charles Nordhoff & James Norman Hall : Paradisfloden.   Roman.  1953 pb 254 s.

44527 Bircher-Benner : Starkare hjärta. Handbok för hjärtsjuka.   1980 hft 122 s.

44534 Esbo idrottsförening          1966-76.       Ill.    1976 sft 88 s.

44536 Leonard Wood : The military obligation of citizenship.  Ill.  1915 klb 76 s.

44538 A J Wyatt : The tutorial history of english literature.      Blyertsförstr. 1949 klb 294 s.

44539 E G Palmen : Tietgen.    Biografi.   Ill.     1917 hft 70 s.

44553 Bengt Frithiofsson : Krogronden. Att äta ute i Stockholm.  Ill.  1981 poc 159 s.

44563 Gabriel Garcia Marquez : Patriarkens höst.    1982 poc 216 s.

44568 Martin Olsson : Riddarholmskyrkan.   Vägledn. för besökare.  Ill.  1958 sft 32 s.

44569 John Stenung : Sancta Clara kyrka.  Historik o vägledning.  Ill.  1952 hft 48 s.

44570 Märta Adelsköld : Sy och prova för hela familjen.   Rikl.ill.STOR. 1933 dekklb 58 s.

45503 Harry Blomberg : Molnens bröder.  Roman.     1937 hft 320 s.

45507 M Noel & M Chapsal : Nouvelle Grammaire Francaise sur un plan….. 1800 pb 220 s.

45509 Sivar Aner : Egil..        1948 hft 235 s.

45511 Sigfrid Siewertz : Spegeln med amorinerna.     1947 hft 259 s.

45515 Gert Aurell : Sötvattenakvariet.  Rikl.ill.     1954 hft 154 s.

45517 Henry Miller : Sexus I.       1965 poc 243 s.

45518     -  ”  -         : Sexus II.       1965 poc 214 s.

45519 Dikterna om Finlands kamp.  44 förf. dikter.     1940 hft 165 s.

45521 Fjodor Dostojevskij : Brott och straff.  Lite sned.    1985 poc 633 s.

45522 Malcolm Wallerstedt : Taxar. Vår populäraste hundras. Ill.   1963 hft 205 s.

45523 Faye Hammel & Sylvan Levey : Hawaii on $10 a day.  Resehandbok. 1974 hft 259 s.

45525 Väinö Linna : Söner av ett folk. Ur torpartrilogin.    1979 poc 472 s.

45527 Konsthallen (Hfrs) : Nyare norskt monumentalmåleri.  Ill.   1937 sft 25 s.

45529 Balkongtal under Strindbergfestivalen 1995. 10 olika förf.   1995 hft 63 s.

45533 August Cohn : Några synpunkter på kriget såsom det ter sig för ……. 1916 sft 24 s.

45534 Sotheby : Catalogue of the Westbury collection of Cookery Books. Ill. 1965 hft 100 s.

45540 Dagmar Edqvist : Angela Teresas gäster.     1955 pb 252 s.

45541 Oscar Wilde : Lord Arthur Saviles brott.     1905 hft 117 s.

45545 V Sirin : Han som spelade schack med livet. Roman.    1936 hft 265 s.

45548 Victor B Scheffer : Lille valen. Faktabok. Ill.    1974 hft 109 s.

45550 William D Blankenship : Yukon Gold. Guldruschen 1898.   1979 inb 252 s.Op

45551 Oscarsteatern,Stockholm 1955-59. Inbundna programblad.           pb ca 100 s.

45553 J Languen : Nouvelle Chrestomathie Francaise ou Recueil classique …. 1812 pb 168 s.

45554 Viveka Starfelt : Skärvan i ögat.   Roman.     1949 inb 294 s.Op

45555 Helmer Winter (utg) : Svenska klassiska lyceets i Åbo katalog.Teologien. 1946 hft 127 s.

45559 David Beckham-official 2005 calendar. Inplastad,oöppnad.STOR.  

45561 FRK : Hjälp vid sjukdoms- och olycksfall. Ill. handbok.   1955 hft 135 s.

45563 Avery Corman : Kramer versus Kramer. Engelsk.    1977 poc 191 s.

45567 Olof Mustelin : Privatarkiven och de vetenskapliga biblioteken.  1972 sft 18 s.

45568 Stig Ericson : Mål ! Tigrarna i cupen. Ishockeybok.    1975 pb 131 s.B

46506 Tord Hubert : Fällan.  Fr Norrland.     1975 inb 235 s.Op

46508 Moderna museet : Ivar-Lo Johansson och konsten.  Ill.  1990 hft 45 s.

46510 Kinsey & Pomeroy m.fl. : Kvinnans sexuella beteende I.    Ill. 1968 poc 287 s.

46512 Salon Gahlin 1970. Ill.      1970 poc 107 s.

46517 David Williams : Blod och sand.     1978 klb 240 s.

46518 Barbro Scherrer : Året runt med kungafamiljen. Vårt kungapar 12. 1987 hft 64 s.

46519 Martin Hurlimann : Kyoto. Engelsk.   Rikl.ill.   1962 inb 180 s.Op

46520 C M Charles : Ordning och reda i klassen.    1984 hft 296 s.

46522 Bengt Anderberg (red) : Kärlek 2.     1965 poc 160 s.

46523 Evelyn Herbert : Paris är för älskande.      1955 hft 255 s.

46526 Johan Ulfvens : Rekord i smultron o andra naturessäer.  1991 hft 144 s.

46529 Harry Blomberg : Det brinner i snön.    1952 klb 256 s.

46530 Vierros-Paasivirta-Riikonen : Världshistoria 2.     Ill.   1971 pb 307 s.

46532 Louis Bromfield : När regnet kom. Fr. moderna Indien.  1944 pb 311 s.

46533 R K Narayan : Läraren och hans hustru.    1953 pb 302 s.

46534 G Westin Silverstolpe : Nationalekonomi för alla.   Förstr.  1947 hft 249 s.

46536 Sigfrid Siwertz : Förtroenden.     1945 hft 320 s.

46537 Leo Tolstoj : Anna Karenina. Filmversionen m. filmbilder.  1936 pb 127 s.

46541 Claude Lorrain : Sketchbook.  ( i Nationalmuseum,Stkhlm)  Ill. 1984 kart 87 s.

46552 David Outerbridge : Handbok för bakfulla.   Ill.   1986 kart 103 s.

46553 Maksim Gorkij : Min första kärlek.     1995 poc 74 s.

46554 Katarina Mazetti : Grabben i graven bredvid.   2001 poc 191 s.

46557 Harry Potter-kalender 2002.  Oanvänd. Ill.           kart 160 s. 

46564 Peter Ryan : UFO-Oidentifierade flygande föremål. Rikl.ill.  1975 hft 48 s.

46565 Roland Schutt : Kådisbellan.   Självbiogr.    1994 poc 265 s.

46567 ABC – Hylands hörna.            Rikl.ill.    1966 sft 36 s.

46571 Jackie Collins : American star.  På svenska.    1994 poc 507 s.

46573 H M Konungens hovmarskalksämbete : Bilder från Stockholms slott. 1951 hft 32 s.

46575 Svenska turistföreningen : Årets bilder 1954-55.  STOR.           hft 82 s.

48503 Svante Beckman : Långt borta och nära. Framtiden i histor. belysning.  1980 hft 91 s.

48506 E Ekegårdh m.fl. : Smårätter. Modernt ,gott,lättlagat.   Ill.    1952 hft 104 s.

48509 Björn Wittrock & Stefan Lindström : De stora programmens tid. Svensk politik. 1984 hft 186 s. 

48514 Katherine Pancol : Jackie Kennedy-bakom masken.     1977 hft 208 s.

48515 Anders Harning : Gerilla. Noveller.       1975 hft 176 s.

48516 Leonard Strömberg : Små fina vita händer.      1980 inb 256 s.Op

48518 C E Sjöstedt : Översikt av den formella logiken.     1936 pb 59 s.

48519 Scandia-tidskr.f. histor. forskn.Bd 60 bla Svenska militärstaten,självstyre i Blekinge 1994 hft 198 s.

48523 Bengt Söderbergh : Fem famnar djupt.        1953 hft 227 s.

48524 Lengstrand & Rolen : Ponnyklubben och den vita hingsten.  Med bilder.  1972 kart 80 s.

48526 Eduard Bernstein : Socialismens förutsättningar och socialdemokratins uppgifter. 1979 poc 284 s.

48527 Gustav Sandgren : Tiggaropera.       1949 hft 132 s.

48529 Juris Kronbergs : Fakta om Baltikum.  Rikl.ill.     1995 kart 61 s.

48530 Jurgen Habermas : Zur Logik der Sozialwissenschaften.    1985 poc 607 s.

48531 David Horowitz : Från Jalta till Vietnam.   USA:s utrikespolitik.   1966 poc 378 s.

48532 A Andrewes : The greek tyrants.   Rikl.förstreckn.     1962 inb 164 s.Op

48533 Gunnar Sillen : Stiga vi mot ljuset. Industri- o arbetarminnen.   1977 hft 111 s.

48534 K A Blom & S Bergström : Svenska brott. Fr. Salaligan till Mattias Flink.  Ill. 1999 poc 107 s.

48540 Georg Landberg : Historia-ett orienteringsförsök.     1954 hft 148 s.

48541 Sverre Lysgaard : Arbeiderkollektivet. De underordnedes sosiologi.   1981 hft 258 s.

48543 Krister Wahlbäck & G Boberg :Sveriges sak är vår.Sv.utrikespolitik 1939-45. Ill. 1966 poc 258 s.

48550 Friedrich Jaeger & Jörn Rusen : Geschichte des Historismus.    1992 hft 259 s.

48551 Harald Höffding : Den stora humorn. Psykologisk studie.    1967 poc 174 s.

48553 Johan Bergström : Hitom Utsira. Om norska målaren Lars Hertervig.   1990 poc 191 s.

48554 John William Nylander : Hemma och utomlands. Skisser och brev.  Ill. 1909 hft 155 s.

48555 Göran Therborn : Klasstrukturen i Sverige 1930-80.      1981 poc 178 s.

48557 Stephen King : Cujo.   På svenska.       1986 poc 342 s-

48559 Cora Sandel : Bara Alberte.        1948 pb 296 s.

48561 Gerlinde Fiedler : Yoga hjälper.  Handbok.  Rikl.ill.    1972 inb 78 s.Op

48562 MorrisWest : Harlekin.  Nutidsthriller.      1975 inb 287 s.Op

48563 A V Lundstedt : Om lösöreköp.   Studie.      1912 hft 122 s.

48564 Max Fourny : Musee d´Art Naif.  Rikl.ill.      1986 sft 40 s.

48565 Galleri Otso : Andligheten i rysk konst.   Rikl.ill.   1991 sft 44 s.

48568 L-G Björklund : Sporten i dag 1982-83.   Rikl.ill.     1982 kart 123 s.

48573 Olle Holmqvist (red) : Att styra livet. Genforskning.   Ill.  1981 hft 159 s.B

48575 Frederick Forsyth : Inga ormar på Irland.      1993 poc 256 s.

48576 Birgit Tengroth : Jag vill ha tillbaka mitt liv.      1972 inb 216 s.Op

48577 Carl-Uno Sjöblom : Frågelek 2.Roliga frågor för stora o små. Ill.   1984 hft 128 s.

48579 Gary G Forrest : Hur man klarar av att leva med någon som har alkoholproblem. 1994 hft 132 s.

49502 Sidney Sheldon : Blodsband.       1980 inb 255 s.Op

49506 Erik Jarneberg : Hagby renhållningsförbund 1946-86. Minnesskrift. Rikl.ill.  1986 kart 95 s.

49507 Torsten Björkman & K Lundqvist : Från MAX till PIA. Reformer inom arbetsmiljö. 1981 hft 436 s.

49508 Peter M Blau & W Richard Scott : Formal organizations.A comparative approach. 1963 hft 312 s.

49509 Iwan W Fischerström : Räkor.   75 recept.   Ill.     1964 hft 47 s.

49511 Viva Reenstierna : Konstnärsparet.         u å  hft 94 s.

49512 Emelie Flygare-Carlen : Ett lyckligt parti.      1914 hft 155 s.

49514 Vivi Edström & P A Henricson : Svenska noveller. 40-tal författare medv.  1970 poc 400 s.

49517 Melvin Burgess : Burning issy.       1992 kart 154 s.

49519 Ulf Grubbström : Smörgåsar och smårätter.   Rikl.ill.    1961 kart 64 s.

49521 ABF i Norden : Genom Norden till Europa och världen.   Inlägg.   1969 hft 181 s.

49522 Joh. Ludv. Runeberg : Fänrik Ståls sägner I-II.   1927 pb 92+83 s.

49523 K Ahlinder & K Garcia & B Gustafsson : Spegel,spegel …säg mig vem jag eg. är. 1982 poc 120 s.

49524 Hjalmar Söderberg : Martin Bircks ungdom.     Lite förstrckn.   1958 hft 154 s.

49525 Lars Gyllensten : Palatset i parken. Retoriskt porträtt i G Archimboldos maner. 1970 hft 214 s.

49529 Hugo Valentin : Den fjättrade Clio.    Ill.             Förstreckn.    1958 hft 188 s.

49531 Paul Naville : Guide de la Vieille Geneve.    Rikl.ill.     1973 hft 112 s.+karta

49534 Eyvind Johnson : Nu var det 1914.       1970 poc 167 s.

49535 Bengt V Wall : De profundis.       1947 hft 189 s.

49536 Sture Källberg : Rapport från en medelsvensk stad:Västerås.    1969 poc 232 s.

49537 Peter Greenhalgh & E Euopoulos : Deep into Mani. Fr. southern tip of Greece. Ill. 1985 hft 171 s.

49538 Margareta Brumer & Birgitta Sidh : Näringslära.   Rikl.ill.    1974 hft 71 s.

49539 Oscar Levertin : Fyra författarporträtt. Rydberg,Strindberg,Heidenstam,Lagerlöf. 1962 poc 133 s.


49541 Per E Rundquist : Generalen.       1953 hft 335 s.

49542 Olof Lagercrantz : Färd med Mörkrets hjärta. Om Joseph Conrads roman.  1988 poc 194 s.

49543 Banta nu ! 6 bra sätt att bli smal.       1974 poc 127 s.

49544 Lars Görling : Triptyk.        1964 poc 234 s.

49545 Sigge Stark : Lycksökerskan.       1952 klb 139 s.

49546 Margrit Diethelm & Carin Tideström : Lätt och läckert-mat med ost. Ill.  1967 hft 92 s.

49547 N Björnsson:Svenska järnvägarnas kontorspersonal och arbetsledarförbund 1912-62. 1962 hft 244 s.   Ill.

49549 Björn Kurten : Den svarta tigern.. Roman.      1984 poc 252 s.

49553 Bengt Abrahamsson : Militärer,makt och politik.  Aktuellt ämne.   1972 poc 214 s.

49554 Per Gunnar Evander : Måndagarna med Fanny.     1974 hft 208 s.

49557 Arne H Eriksson : Den nya vänsterns ideer.      1967 hft 43 s.

49558 Åke Wassing : Dödgrävarens pojke.   Fr. Hälsinglands skogar.   1971 poc 480 s. 

49560 Bunny Ragnerstam : Uppbrottets timme.    Dokumentärroman  fr. 1883.  1976 poc 290 s.

49561 Christian Necke : ”Sicket ett hus di har byggt …” 99 års teater i Helsingborg. Ill. 1977 kart 137 s.

49564 Hjalmar Bergman : Clownen Jac.  Förf. sista roman.     1982 inb 299 s.Op

49565 Sara Lidman : Jag och min son.       1963 pb 248 s.

49566 John Plamenatz : German marxism & russian communism.    Förstreck.   1965 hft 356 s.

49567 William Ashworth : Världens affärer.  Ekonomisk historia 1850-1960.  1970 poc 300 s.

49568 Georges Lefebvre : 1789.   Franska revolutionen.     1961 poc 191 s.

49569 Färg AB International : Handbok för båtägare.Plast- , trä-, metallbåtar. Ill.  1979 hft 192 s.

49571 Carl Nordenfalk : Klassisk konst i alla hem. Mästerverk fr. skilda tider. Ill.  1966 spiral 48 s.

49573 Gunnar Oldin : Gambling.   Poker o andra spel. Ill.     1978 poc 120 s.

49574 Tore Zetterholm : Turisterna.       1976 inb 168 s.

49575 Lars Andersson : Bikungskupan.         Värmlandsroman.    1982 inb 308 s.Op

49578 Hundsport nr 1-4  - 1981.Kennelklubbens tidning.   Rikl.ill.            sft 60 s. /nr

49580 Nils Andren : Svensk statskunskap.                  Förstreckn.    1965 inb 313 s.Op

50502 Erland Ehnmark : Världsreligionerna.   Ill.  1955 pb 218 s.

50503 Karin Thelander (red) : Lär oss att födas. Antologi om döden. 1975 hft 80 s.

50504 Edith Ekegård . Det bästa brödet.  Ill.   1950 hft 128 s.

50506 Lennart Sundström : Hur man ser Stockholm. Ill. vägledning. 1949 hft 160 s.

50511 Juhani Aho : Domen. Skådespel i tre akter.  1908 hft 134 s.

50512 Herman Sandegren : Kast och kristendom i Sydindien.  Ill. 1921 hft 259 s.

50513 Michael Holm : Udda Eros.   Ill.   1971 hft 89 s.

50515 Vibeke Olsson : Ulrike och kriget.   1975 inb 132 s.Op

50517 Georg Dahl : Den odödlige conquistadoren.  Fr. Karibien. 1947 hft 257 s.

50518 Wald. Edvardsson : Säg ja till livet.   1954 hft 91 s.

50519 Viking Lobbas : Flykt.  Dikter.   1980 hft 58 s.

50520 James Hemming . Tonårsflickornas problem.   1961 hft 179 s.

50521 Britta Munk : Hotel Hanne.   1954 pb 84 s.

50522 Erling Eidem : Den lidande guden.   1932 hft 144 s.

50523 Rosa Thörne : Alvilda mark.  Berättelse.  1924 pb 190 s.

50524 Svenska kulturfondens skrifter nr 1 : Kultur i omvandling. 1966 hft 92 s.

50525 Sigfrid Siwertz : De stora barnen.   1915 hft 297 s.

50526 Sigge Stark : Främlingens gåva.   1987 hft 141 s.

50527 Henry Miller : Plexus I.    1958 hft 319 s.

50528 Erik Noreen : Valda stycken av svenska författare 1526-1732.Förstr. 1964 hft 237 s.

50529 Kay-Vilhelm Winqvist m.fl.:Svenska partiapparater.  1972 poc 314 s.

50530 Bo Björkman : Sverige och sossarna. Varnande exempel.  Ill. 1973 hft 99 s.

50531 Robert Barr : Folkgunst. Berättelsen om en stor strejk.  1897 hlvklb 209 s.

50532 Olle Nyman : Ny författning.   1969 poc 240 s.

50533 M Nilsson : Kaskad-virkbok.  Rikl.ill.      uå  sft 23 s.

50534 Torsten Husen m.fl.: Vuxna lär.  Vuxenundervisningen. 1962 inb 240 s.Op

50535 William C Havard : Hur USA styres.   1969 poc 234 s.

50536 Michael Kaser : Ekonomin i Sovjet.  Rikl.ill.  1970 hft 254 s.

50538 Denis Bauchard : Spelet om oljan.   1971 poc 136 s.

50541 AlanLoyMcGinnis : Kärleksfaktorn.   1984 poc 191 s.

50542 Finn Tofte : Att bygga bo.   Rikl.ill.   1958 pb 160 s.

50546 Tage Jander : Bornholm.  Rikl.ill.   1964 hft 70 s.

50547 Rune Lagerqvist : Svenska vägboken.     1972 hft 288 s.

50550 Carl-August Bolander : Det snöar i Menton.  1956 hft 320 s.

50552 Gavin Orton : Eyvind Johnson. En monografi.  1974 poc 175 s.

50553 Homere : Hymnes. Texte etabli et traduit.  Fransk.  1967 hft 250 s.

50557 Tomas Mikael Bäck : Flytande avsatser.  Dikter.  1986 hft 37 s.

50558 Anker Aggebo : Konsten att åldras rätt.   1961 pb 158 s.B

50569 Georg Holmsten : Elisabeth von Öserreich.Kaiserin Sissi. 1957 inb 543 s.Op

50571 Kristina Hjerten : Kod 4. Dokumentärroman om bröstcancer. 1980 hft 173 s.B

50572 Hans Martin : Arvet.    1969 hft 263 s.

50573 Tyra Molander m.fl.: Ritas sylexikon.  Rikl.ill.  1964 pb 111 s.

50574 Ragna Kellgren : Uppror eller nya lärodikter.  1963 hft 51 s.

50575 Finn Friis : Förenta Nationerna. Mål-medel-verksamhet. 1965 poc 313 s.

52502 Minnesskrift vid Allmänna svenska prästföreningens 25-årsjubileum. 1928 hft 126 s.

52503 Göran Tunström : Prästungen. Berättelse.  1985 poc 271 s.

52505 Ruth Carter Stapleton : Tro och psykisk hälsa.  1977 poc 128 s.

52506 H Hallila & R Riitesuo : Föreningsverksamhetens grunder. 1990 hft 120 s.

52507 Jonas Kjellin & Åge Ramsby :Kort rapport om sensiträning.   1972 hft 62 s.

52509 Hugo Högnäs : Pubertetstiden en orsak till ungdomsbrottslighet. 1931 sft 52 s.

52510 John Steinbeck : Pärlan.    1971 poc 127 s.

52511 Prosten Heumanns läkemedel.   Ill.   1927 hft 287 s.

52514 Jens Enqvist : Nära havet.   Dikter.   1989 hft 59 s.

52515 Edith Ekergård m.fl.: Smårätter.Modernt,gott och lättlagat. Ill. 1952 hft 104 s.

52516 Nils Erik Landell : Fågeldöd fiskhot kvicksilver.  Ill.  1968 poc 133 s.

52517 Aristofanes : Riddarna / Lysistrate.   1968 poc 158 s.

52518 Årets rysare – 16 chocknoveller.   1972 hft 142 s.

52520 Gunnar Rudberg : Ur Hellas´ liv.   1934 hft 308 s.

52521 Björn Kurten : Människans utveckling.  Ill.  1963 poc 176 s.

52522 Victor : Victors nya ordpuppa.  Dikter.   1980 hft 49 s.

52524 Vladimir N Vojnovitj : I goda vänners lag.  1980 hft 215 s.

52526 Alejo Carpentier : Den förlorade porten.  1969 poc 253 s.

52527 Ottar nr 1 –1983 : Otrogen – mot vem ?  Moral,trohet o otrohet. Ill. 1983 hft 104 s.

52528 Stellan ( Bengtsson) –pingisspelaren. Med bordtennisskola. Ill. 1973 hft 95 s.

52529 Maksim Gorkij : Mina universitet.   1971 poc 141 s.

52532 Inger Jensen & F Vestergaard : Praxis och tröghet. Om J-P Sartre. 1979 hft 64 s.

52535 Pierre Tuetey : Cours de Langue et de Litterature Francaise. 1840 pb 374 s.

52536 Agne Gustafsson : Hur går det med demokratin ?  Debatt. 1971 poc 192 s.

52537 Martin Olsson :Om målad fasaddekorering under medeltiden. Ill. 1918 sft 20 s.

52538 Lilla reseparlören. Svensk-tysk  Deutsch-Schwedisch.                          u å hft 112 s.

52541 Peter Bromhead : Life in modern Britain.   Rikl.ill.  1974 hft 227 s.

52543 Albert Lilius : Om småbarnens själsliv.   Pärmskada. 1917 hft 108 s.

52546 Hans Wattrang : Det kalla kriget. Ioll.  1963 pb 170 s.B

52548 Erik Ask-Uppmark : Huvudvärk-dess orsaker och behandling.  Ill. 1970 hft 106 s.

52549 Burt Hirschfeld : JR.  Om TV-serien Dallas.  1982 pb 259 s.B

52550 Frank Bonham : Attack i Burma.   1978 pb 240 s.

52553 T S Dillner :En samling översättningar o bearbetningar fr. romerske o franske förf. 1899 hft 143 s.

52554 Ingvar Johannesson : Tonårspsykologi.    Ill.  1974 poc 116 s.

52556 C M Jones & Angela Buxton : Börja med tennis.  Rikl.ill. 1976 hft 79 s.

52557 Risto Rasa:Grå,svart och brun som luffarens är sparvens dräkt.Dikter.1978 hft 64 s.

52558 Walt Morey : Sista dykningen.  En Bergh-bok-en topp-bok. 1976 pb 237 s.B

52559 Per Göranson : Ambassadören griper makten.   1974 hft 223 s.

52560 Samfundet Sverige-Finland.  Jubileumsmatrikel 1924-1999.         hft 77 s.

52561 Paavo Kastari : Presidenterna och deras ställning.      Finland idag. 1967 hft 83 s.

52562 Ernst C:saon Bredberg : Äventyr i djuphavet.  Spionthriller. 1956 hft 168 s.

52563 Havsforskning i dag. 14 föredrag fr. Ingeniörvetenskapsakademien. 1970 poc 143 s.

52565 Victor Canning : Skogen har tusen ögon.  Spionageroman. 1952 pb 235 s.

52567 Daphne du Maurier : Lady Dona.   1952 pb 256 s.

52568 Författningar rörande kommunallifvet på landet med sakregister. 1912 pb 288 s.

52571 Jan-Åke Alvarsson : Anselmo. Indianber. fr. Bolivia.  1979 hft 126 s.

53501 Yngve Åström . Som sömnen finns.   Dikter.                                  1956 pb 60 s.

53502 Hannula – Larjanko : Du och din hälsa.   Rikl.ill.                                  1978 hft 137 s.


53505 Iride Mariani : Genom natten.  Dikter.       Pärmfläckar.                      1945 hft 89 s.

53506 Ulf Christoffersson m.fl:Byråkrati och politik. Svenska statstjänstem.                      1972 hft 176 s.

53507 J J Tikkanen : Tizian.   Ill. biografi.                                                      1916 hft 70 s.

53509 Åke Gissler : Lär dig bokföring. Vasa handelsläroverks publ. Nr 1.                      1957 hft 309 s.

53510 Lennart Frick : Dagen D.    Dikter.                                                1992. hft 64 s.

53515 Jacynth Hope-Simpson : Svarta madonnan.  Ungdomsthriller.         1978 hft 118 s.

53516 Kirsten och Svend Carlsen : Vägen till bättre kondition.  Rikl.ill.                      1972 hft 76 s.

53519 Edith Ekergårdh : Grönsaksgott.   250 recept.  Ill.                                            1951 hft 104 s.

53520 Victor : Dikter av en blivande Nobelpristagare.                                           1978 hft 48 s.

53523 J L Runeberg : Älgskyttarne. Skolupplaga.                         1963 hft 112 s.

53524 Historia del Palamos C F – en comic.            STOR.                                 1980 sft 36 s.

53525 Else Storbjörk : Ett liv värt att leva.                                                                  1986 hft 103 s.

53527 Axel L Romdahl : Ögats fostran. Tal vid Göteborgs konstmuseum.                      1949 sft 24 s.

53529 J O Åberg : Spåqvinnan (Mamsell Arfvedson). Fr. Gustaf III:s tid.                      1887 dekklb 138 s.

53531 Raymond Hawkey o Roger Bingham : Ingreppet.  Visionär thriller.                      1975 inb 307 s.Op

53533 Bordtennis-världens snabbaste spel. Massor av råd o anvisn. av elitspelare.u å sft 32 s.

53535 Sinclair Lewis : Vår mr. Wrenn.                                                       1934 hlvfr 335 s.

53536 John H Goldthorpe m.fl.:Arbetaren i överflödssamhället.Beteenden ..                      1971 poc 284 s.

53538 Lennart Nylander : Orgel och harpa.  Dikter. Ex libris.                               1942 hft 84 s.

53539 Statens tryckericentral : Byggnadslagstiftningen.                                1982 hft 138 s.

53540 Frank G Slaughter : En skövlad trädgård.                               1958 inb 392 s.Op

53542 Hammond Innes : Atlanten rasar.                                                             1964 pb 309 s.

53544 Rud. Otto : Indiens nådesreligion och kristendomen.                       1927 hft 62 s.

53545 Ottar 1/1986. Möt AIDS med kunskap,kärlek och kondom.  Ill.                   hft 96 s.

53546 Joan Grant : Horisontens väktare.  Fr. Egypten.                               1945 hft 358 s.

53548 Arne och Vera Forsberg (red) : Stockholms stift 1942-1982.  Ill.                      1982 hft 137 s.

53549 Swärds golfbok I.    Rikl.ill.                                                        2003 hft 121 s.

53550 Ulf Karmi : Hemmets extas.   Dikter.                                                        1956 sft 19 s.B

53553 V Jastrau : Ejnar Nielsen.  Konstnärsbiografi med ill.                              1930 hft 47 s.

53554 Luis Padrosa : Varför jag lämnade katolicismen.                         1953 hft 111 s.

53555 Georg Johnsen : Brev till en sjuk vän.  Hjälp för tunga dagar.                      1982 hft 48 s.

53556 Anatole France : Den röda liljan.                       Fuktfläckar.                            1934 hlvfr 271 s. 

53559 Börje Crona : Något gott i 2080. Sci-fi-noveller.                            1979 poc 163 s.

53560 Manuel Scorza : Den sömnlöse ryttaren.  Indianernas kamp.                      1981 poc 175 s.

53561 Elechi Amadi : De stora dammarna.  Afrikansk roman.                                  1980 hft 245 s.

53562 Kerstin Göransson m.fl.: Hjälpmedel för begåvningshandikappade.           u å  hft 91 s.

53564 Olle Söderlund Medvindsmannen.  Humoristisk roman.                      1986 inb 234 s.Op

53566 Trygve Hedtjärn m.fl.: Fredspolitik-Civilmotstånd.                       1971 poc 232 s.

53567 Bunny Ragnerstam : Uppkomlingen.En svensk tragedi.                      1982 poc 284 s.

53568 Brita Schlyter : Lek och leksaker. En Prisma-handbok.           Ill.                      1972 poc 166 s.

53569 Frank Heller : Storhertigens finanser.                                                     1966 inb 248 s.Op

53570 Göran von Bonsdorff : 100 frågor om freden.                                 1984 hft 168 s.

53571 Med egna ord !  Ett urval insända bidrag till Aftonbladet/UNGs tävl.         1980 poc 200 s.

53572 Alexandre Dumas : The black tulip.                                                  1975 dekklb 252 s.


53574 Loulou Forsell : Sångarbarn.  Prisbelönad.                          1952 hft 243 s.


54502 Folke Renström: Från 1892 års till 1960 års brandstation i Uppsala. 1960 hft 48 s.  Ill.

54504 Att vara synskadad. Utg.: De blindas förening.  1971 hft 173 s.

54505 Hans Peterson: Cecilia.    1961 pb 232 s.

54507 C O Carter: Människans arvsanlag. Ill.  1966 poc 223 s.

54508 Desmond Bagley: Bahamakrisen.   1980 poc 270 s.

54510 Sven-Eric Liedman: Från Platon till Mao Zedong. Polit. ideernas historia.1979 poc 284 s.

54513 Olle Nyman: Utländska statsskick. En komparativ översikt. 1968 poc 200 s.

54514 Studier i nordisk filologi nr 26: Studier över alliterationen i Eddan. 1936 hft 179 s.

54516 Stig Hadenius m.fl.: Sverige efter 1900. En modern politisk historia. 1978 poc 350 s.

54519 Frank G Slaughter: En läkares samvete.   1969 pb 254 s.

54523 Sv. Numismatiska föreningen: Medaljer utg 1873-1998.Belöningar .. 1998 hft 85 s.

54526 Svenska glimtar. En dörr till Sverige ställs på glänt av Erik Goland. 1976 sft 56 s.

54527 Klas Östergren: Fantomerna.   1982 poc 258 s.

54529 Gösta Wadensjö: Sverigekunskap.  Rikl.ill.  1980 hft 216 s.

54531 Tom Okker: Tennis in pictures.    Rikl.ill.  1976 hft 160 s.

54532 Björkman-Lundberg-Magnusson: Psykologi.  Rikl.ill.  1968 pb 216 s.

54534 Giuseppe Gatt: Gainsborough. 80 colour plates + text.  1979 hft 120 s.

54536 E R Burroughs: Tarzan –presentalbum.   STOR.  1980 hft 48 s.

54541 Herman Kahn: The coming boom.  Economic,political and social. 1982 hft 237 s.

54542 Ellinor Reimer-Eriksson: Vi går I Montessoriklass. Rikl.ill.   u å kart 50 s.

54546 Anton Nyström: Alfabetiskt register till Allmän kulturhistoria. 1893 klb 61 s.

54551 Gary Larson: The far side.    Tecknad serie.  1993 hft 104 s.

54553 Åke Hansson: Kort handledning i Biskötsel.   Ill.  1954 hft 136 s.

54554 John Takman (red): Napalm.  Kemisk o biologisk krigföring. Ill. 1967 poc 189 s.

54555 Owe Husahr: Nattens väv.   1954 klb 258 s.

54558 J Ehrenberg: Hong Kong-ett reportage.   1984 poc 127 s.

54560 Olof Lagercrantz: Ett år på sextiotalet.   1991 poc 250 s.

54564 E Weer: Det unga Polen. En samling berättelser.  1981 pb 214 s.

54566 Pelle Sollerman: Berättelsen om Gotlands Folkblad.  Ill. 1978 hft 159 s.

54569 Bo Widerberg: Den gröna draken.   1965 poc 224 s.

54570 Jörn Donner: Gabriels dag.   1985 poc 297 s.

54571 Mignon G Eberhart: Död mans vilja.  Wahlströms detektivserie. 1954 klb 256 s.

54572 Jag flög till början av livet. Texter fr. åboländska verkstäder 2001. 2001 hft 111 s.

54573 Dalai Lama &Howard C Cutler:Lycka.En handbok i konsten att leva. 1999 poc 316 s.

56502 Gunnar E Sandgren: Blaskan.   1970 poc 166 s.

56505 Stig Malmberg: Mot målsnöret.   1958 pb 156 s.

56506 Lars Widding: Inga stormar än.   1973 poc 188 s.

56508 Förordn. angående åtgärder till förekommande av skogsskövling.. 1918 pb 141 s.

56509 Dave Berg: Mad´s ser och hör och garvar.  1980 poc 128 s.

56510 Stig Cederholm: Åsa-Nisses bravader.   1968 inb 253 s.Op

56512 John Tarrant: Likvidera Rommel.   1978 klb 240 s.

56514 Sven Green: Blommor inne.   Rikl.ill.   1976 kart 96 s.

56515 Max Lundgren: IFK Trumslagaren och Lillis.  1979 hft 120 s.

56516 Rudolf Laur-Belart: Fuhrer durch Augusta Raurica.  Rikl.ill. 1966 hft 188 s.

56517 Gunnar Rudberg: Hellas och Nya Testamentet.  1929 hft 285 s.

56521 Gunnel & Kjell Swärd: Tankekorn.   1991 hft 126 s.

56522 Per-Hakon Påwals: Snuviga gatlyktor.  Historietter.  1960 hft 92 s.

56523 Dan Brown: Angels and demons.   2001 poc 620 s.

56524 Karl Warburg: Svensk litteraturhistoria i sammandrag.  1927 klb 180 s.

56525 Lennart Frick: Läsvärt.  50 svenska böcker 1975-78.  1978 poc 118 s.

56526 Monica Träskböle: Som ett ensamt träd.  Dikter.  1969 hft 66 s.

56527 Norbert Kunze: Den sista bron.  Filmad. Fr. Österrike.  1955 hft 139 s.

56528 Anita Wikman: Balladen om Siimas-Fii och Sjunga-Matt.  Ill. 1983 hft 40 s.

56529 Svenska folkakademin 1908-48.  Historik o elevförteckning. 1948 hft 72 s.

56532 Olof Mustelin: Ett brev fr. 1827 av Immanuel Ilmoni om universitetes förflyttning.1952 sft 7 s.

56534 F George Kay: På  liv och död. Jenner,Pasteur,Ross,Lister,Fleming. 1972 pb 126 s.B

56535 Lisa Högelin: Mona hoppar av.   1955 pb 163 s.

56536 Söderhavshövdingen Tuiavii: Den vite mannen-Papalagi. 1988 poc 139 s.

56541 Anne Tyler: Den andre brodern.   1975 inb 331 s.Op

56542 Kaija & Markku Valkonen: En enda fest. Finland festivals.  Ill. 1994 hft 156 s.

56544 Bobby Andström: Det kungliga året 1989. Rikl.ill. STOR. 1989 hft 64 s.

56545 Husmodern: De minnen vi älska II.Vår historia skildr. av våra förf. 1941 klb 172 s.

56548 Albert Schweitzer: Fred eller atomkrig ?  1958 sft 36 s.

56549 Arne Anka: Bombad & sänkt.  Självbiografi o Stockholmshistoria. 1996 poc 182 s.

56550 Sigge Stark: Kärleken segrar.   1955 pb 188 s.

56552 John Gardner: James Bond in Win,lose or die.  1990 poc 390 s.

56553 Charlotte Green: Jag skall alltid minnas dig …..  1966 hft 229 s.

56554 Christopher Isherwood: Farväl till Berlin.   Fr. 30-talet. 1962 poc 202 s.

56557 Erik Granvik: Två  göukar.   Dikter.   1972 hft 56 s.

56558 Sigfrid Siewertz: Förtroenden.   1960 poc 244 s.

56559 Liljevalchs konsthall: Katalog n:o 20-Nyare dansk konst.Ill. 1919 hft 84 s.+planscher

56560 Johan Ludvig Runeberg: Kung Fjalar. En dikt i fem sånger. 1919 pb 64 s.

56561 J P Valkema Blouw: Med palett och pensel el målning med oljefärg. 1943 hft 40 s.

56563 Ylva Eggehorn: Skärgårdsturne´n.   1998 hft 78 s.

56564 Pierre Bouille: Bron över floden Kwai.   1958 pb 216 s.

56565 Oscar Fredrik: Dikter.    1907 klb 130 s.

56566 A Chr. Westergaard: Skeppspojkar.   1939 pb 154 s.

56567 Erik Palm: Uppslagsbok för skrivbordet. Regler,affärsbrev,jurid. handl.1957 pb 301 s.

56570 Hans Martin: Höst.    1962 hft 372 s.

56572 Åke Söderqvist: Skäggets andra fräckisar.  Ill.  1966 hft 111 s.

56573 Tom Clancy´s Power plays Cold war.   2001 poc 337 s.

56574 Amleto Vespa: Hemlig agent åt Japan.   1939 hft 254 s.

56575 Perspektiv. Tidskrift för kulturdebatt. Komplett årg. 1957-10 nr.          sft 480 s.

57501 K-A Grandin: 200 limerickar. Ill. av förf.  1981 hft 96 s.

57503 Sven Wikberg: Nordisk litteratur i urval.  1937 pb 241 s.

57504 Sigfrid Siwertz: Liten herre i grå kostym.  Presentbok.   Ill. 1955 pb 80 s.

57505 Lilian Björck-Hempel: Bra mat-bättre hälsa. Liten näringslära.Ill. 1958 hft 126 s.

57507 Hans Martin: Det kortaste strået.   1961 hft 284 s.

57509 Leo Huberman: Människans rikedomar.  Titelblad saknas. 1965 poc 286 s.

57511 Jeanna Oterdahl: De sjungande löven.  Sagospel.  1944 pb 174 s.

57512 Sven Wikberg: Svensk poesi i urval.   1937 pb 252 s.

57513 Eugen Sarrazin: Ridån går. Teateramatörernas fickkalender.  Ill. 1947 klb 125 s.

57515 C G von Christierson: Beskrifning öfver Gerknäs säteri intill 20;nde seklet.1906 hft 20 s. Nött ex.

57518 Birgit Alden & Greta Berg: Djupfryst i hemmet.   Ill.   u å hft  80 s.

57519 Björn Kurten: Människans utveckling. Ill.  1953 poc 176 s.¨

57520 Rolf Edberg: Spillran av ett moln.   1968 poc 176 s.

57521 Robert Malmgren m.fl.:Sveriges grundlagar o tillhörande författningar.1966 klb 271 s.

57524 Ivar Lo-Johansson: Pubertet.   1981 poc 416 s.

57526 Finlands svenska orienteringsförbund: Orienteringens ABC. Ill. 1965 sft 78 s.

57527 C M Schybergson: Anteckningar om Svenska klassiska lyceets i Åbo bibliotek. 1939 sft 22 s.

57528 Georg Granberg: Boken om Funäsdalen.  Rikl.ill.  1950 pb 79 s.

57529 Torsten Bohlin: Herdabrev  för Härnösands stift.  1935 hft 112 s.

57530 Friedrich von Oppeln-Bronikowski: Das Testament des Königs. Ill. 1925 pb 31 s.

57531 ICA provkök: Goda korvrätter.  Ill.   1965 hft 83 s.

57532 Harald Hultman: Första gången i Wien.  Rikl.ill.  1979 poc 120 s.

57533 Perspektiv. Tidskrift för kulturdebatt.  Komplett årgång 1958 – 10 hft.       Sft  sa 482 s.

57534 Johan Wintzell: Sexualkunskap för ungdom.  Ill.  1966 sft 60 s.

57535 Dikken Zwilgmeyer: Yrhättan far till fjällen. Ill.  1951 pb 96 s.

57536 Svea Kulvik: Den tysta trädgården.  Dikter.  1966 hft 62 s.

57537 Hans Lagerberg: Sorgeman och kärleken.  Roman.  1990 kart 212 s.B

57539 Robert Jordan: A crown of swords VII: The wheel of time. 1997 poc 880 s.

57542 Willy Westby & Margareta Lindblad: Inter-rail. Tips för tågluffare. 1988 poc 127 s.

57543 Gunnel Nyblom-Holmberg: En lättskött blomstergård. Rikl.ill. 1955 hft 96 s.

57544 K A Arvidsson/B Segerstedt: Nordiskt måleri. 4 språk. STOR. Rikl.ill.  u å klb 93 s.

57545 Tom Gill: Intermezzo vid gränsen.  Fr. New Mexiko.  1951 pb 256 s.

57546 Luise Rinser: Ein Bundel weissr Narzissen.  1956 pb 264 s.

57548 Barbro von Essen-Holmqvist: Stum stiger frågan.  Dikter. 1976 hft 73 s.

57549 Kenneth Ulyatt: Cowboys.   Rikl.ill. historik.  1960 hft 47 s.

57550 Frida Åslund: Gertru från Svartliden.   1934 hft 181 s.

57553 Vagn Fentz: Gambia.  Rikl.ill. reseguide.  1978 hft 239 s.

57554 Duncan Harding: Operation sjöhästen.   1978 klb 239 s.

57555 Ingrid Sjöstrand: Acceptera det inte. Med noter: C-A & Monica Dominique.1988 hft 95 s.

57557 Max Lundgren: Inga Eliasson – affärsbiträde.  1980 inb 227 s.B

57559 Mark Sylwan: Et ego in Bavaria.  På svenska.  1969 inb 183 s.Op

57560 Sture Ring: Typerna och den datoriserade draken.  Ill.  1981 hft 304 s.

57562 Lef Panduro: Vägen till Jylland.   1978 poc 139 s.

57563 Hundsport.Kennelklubbens tidning nr 12 1980. STOR. Rikl.ill.          hft 138 s.

57564 Bengt Söderbergh: Våren.   1964 hft 250 s.

57567 Göran Börge: Lipsillen.    1971 inb 200 s.Op

57569 Jan Elffers: Trädgård och hem.  Ill.    u å   hft 126 s.

57572 Victor: Kullerbyttor.   Dikter.   1971 hft 80 s.B

57573 Stig Jonasson & C-H Wijkmark: Stormcentrum. Modern tysk prosa. 1964 poc 190 s.

57574 Per Gunnar Evander: Härlig är jorden.   1975 hft 273 s.

57575 Sigge Stark. Tvillingsystrarna.                                             1952 pb 160 s. 

58501 Helene Tursten: Guldkalven.  Irene Huss löser.                           2005 poc 284 s.

58502 Ladislav Mnacko: Bratislava:sju nätter.   Pragvåren –68.             1969 hft 222 s.

58503 H-K Rönblom: Bok över obefintliga.                                             1962 hft 194 s.

58505 Bo Björkman: Sverige och sossarna. Fr. förebild till varnande ex.   1973 poc 99 s.

58506 Heinrich Böll: Die verlorene Ehre der Katharina Blum.                 1974 poc 122 s.

58508 Nationalmuseum: Rembrandt.  66 bilder med texter.                         1956 hft 64 s.

58509 Carina Rydberg: Djävulsformeln.                                                   2001 poc 424 s.

58512 Hugo Holsti: Om lungsot och andra tuberkulösa sjukdomar.               1906 pb 24 s.

58513 Ana Blandiana: Kopi av et mareritt. På norska.                            1927 inb 192 s.Op

58514 Wilhelm M Carlgren: Anteckningar kring Johannes Hellners minne.    1961 hft 38 s.

58517 James A Michener: Sayonara.   Fr. Japan.                                  1955 hft 257 s.

58520 Gourmet: 199 bord. Sveriges bästa restauranger 2002                               hft 194 s.

58524 Rudolf Steiner: Antroposofisk själskalender.                        1980 klb 80 s.

58525 Johan Ludvig Runeberg: Nadescha.  Dikt.                                     1921 hft 83 s.

58526 Torvald Steen: Don Carlos.  Fr. Argentina. På norska.       1993 inb 148 s.Op

58527 Sisela Lindblom: De skamlösa.                                                   2008 poc 318 s.

58528 Historia och framtid. SIF 75 år. Sv. industritjänstemannaförbundet. 1995 hft 153 s.  Ill.

58529 Alice Lyttkens: Hasard med guldmynt.                                         1982 klb 255 s.                        

58532 Iva Maasing: Sportbilar och bilsport.   Ill.                          1962 poc 133 s.

58536 Ingmar Hedenius: Om rätt och moral.                  1963 poc 155 s.

58537 Honore de Balzac: Bönderna.                                           1973 poc 284 s.

58538 Åke Gulin: Kattguld.      Dikter.                                            1970 hft 58 s.

585382 Åke Gulin: Jolly Roger.   Dikter.                                        1967 hft 93 s.

58539 Ulf Grubbström (red): Smörgåsar & smårätter.  Rikl.ill.         1967 kart 54 s.

58540 Sigge Stark: Löftet.                                                               1952 pb 157 s.

58541 Årets dagar 1974. Värt att veta värt att minnas.    Rikl.ill.               klb 168 s.

58542 E A Hellman: Katalog över finska jul- och välgörenhetsmärken. Ill.     1947 sft 32 s.

58552 John Godey: Pelham 123 kapat.                            1974 klb 266 s.

58553 Välkommen till Motala.    Bla Göta kanal.   Rikl.ill.                1971 kart 144 s.

58554 Scandia-tidskrift f. hist. forskning bd 69-hft 1 bla kämnärsrätt i Karlstad  2003 hft 152 s.

58555 Hjalmar Bergman: Swedenhielms. Komedi i fyra akter.                1960 hft 164 s.

58559 Sv. filatelist-förbund: Priskatalog över svenska post- o makuleringsstämplar.1967 hft 96 s.

58560 Axel Hambaeus: Skärvor och helhet. Några ord till mina medmänniskor.1952 hft 127 s.

58562 Ralph Miliband. Marx och politiken. Analyserande diskussion.               1980 hft 169 s.

58565 Fredrik Lagerroth: Levande och dött i frihetstidens statsskick.        1947 hft 75 s.

58568 Svensk elitfotboll: Elitfotbollen 1988.  Rikl.ill.                                hft 162 s.

58569 Svenska bokläggareföreningen: Årets böcker 1983.                     poc 220 s.

58570 Gray Jolliffe & Peter Mayle: Mannens bästa vän.  Rikl.ill.                      1985 hft 62 s.

58573 Th. Jerreborn: Sådd och skörd.  Lyrikantologi. Ill.:Staffan Rosvall.    1955 hft 94 s.

58575 F J Ramberg: Sjömanspastorn berättar.  Ill.         Sned.            1964 hft 94 s.

60503 Yngve Cederholm m.fl.: Naturen som hobby. Ill. handbok.              1952 hft 199 s.

60507 Aleksej  Tolstoj: Nikitas barndom.                                                  1958 hft 152 s.

60508 Daniel W Fry: Resa med flygande tefat.                                          1968 hft 70 s.

60509 Bengt Linder: Tjabo och ruskligan.                                              1976 pb 123 s.

60510 Birgitta Lager m.fl.: Historia kring Stockholm.  Ill.                        1963 poc 154 s.

60512 Frank G Slaughter: Purpursökarna.  Fr. antiken.                           1966 hft 280 s.

60513 Lena Levine & David Loth: Samliv utan kyla.                              1965 poc 183 s.

60514 Reform – Ockupation. Tjeckoslovakien 1968.                               1968 poc 168 s.

60516 Alessandro Alvisi: Sagt och sant om hästar.  Ill.                               1960 klb 90 s.

60518 Malin Lindblom: Öppet brev till en medpatient.                                 1972 hft 139 s.

60520 Christina Lööf: Vem ä´ jag ?                                                           1961 hft 94 s.

60522 Boris Simon: Abbe Pierre.   Ill.                                                 1964 poc 218 s.

60529 Allan Sandström: Dikter.                                       1920 hft 96 s.

60530 John Vikström: Trots allt. Herdabrev till Åbo ärkestift.    1985 hft 99 s.

60531 Ludvig Jönsson: Pilgrim i välfärden                       1976 hft 216 s.

60536 Signe Forsberg: Råd o anvisningar för en lönande fjäderfäskötsel.   1943 hft 144 s.

60540 Lek- o idrottsutskottet av FFF: Lekar I: Bollekar.  Ill.                    1925 hft 82  s.

60543 Karin Thelander: Lär oss att födas. Antologi om döden.                  1975 hft 80 s.

60544 Yasar Kemal: Bomullsvägen.                                                      1974 poc 263 s.

60546 Mathilda Wrede: Bland fångar och fria.                                           1923 hft 128 s.

60549 Arthur Heinz-Lehmann: Majestätet och vi. Två människor o en häst.  1956 hft 196 s.

60551 Chun-chan Yeh: En by i bergen.                                                       1987 poc 253 s.

60552 Gunnar I Nylund: Gnistor av liv.  Prosapoesi.                           1987 hft 39 s.

60553 Henning Pallesen: De avvikande.  Homosexualitet.                        1964 hft 181 s.

60554 Torgny Lindgren: Merabs skönhet.                                              1991 poc 205 s.

60555 Anna Barney: Under palmerna.  Fr. Misiones i Argentina.             1956 hft 156 s.

60556 Eric Linklater: Soldat Angelo.                                                      1950 hft 272 s.

60560 Birgitta Hjelt: Ur sömnens ask.    Dikter.                                  1975 hft 52 s.

60561 Basil Davidson: Svart forntid.   Afrikas historia.  Ill.                       1962 poc 283 s.

60562 Tove Krogius: Den erogena zonen.  Ill. programhäfte.                  1987 sft 42 s.

60563 Kaija Sailo: Vård av döende.  Ill.                                                 1993 hft 89 s.

60564 James Baldwin: Ingen känner mitt namn.                           1962 hft 192 s.

60565 Ernst Wiechert: Den vita buffeln.   Fr. Indien.                          1946 hft 112 s.

60566 Åke Gulin: Visor för vanliga.  Dikter.                                    1974 hft 86 s.

60567 Marcel Ayme: Påfågeln.                              Ill.                      1954 hft 171 s.

60568 Arturo Barea: Spåret.                                                           1965 poc 277 s.

60570 Peter Abrahams: Segrarens krans.  Fr. Afrika.                       1963 hft 232 s.

60572 Dan Sundell: Lille Per.         Dikter.                                            1972 hft 59 s.

60573 Paul Davies: Gud och den nya fysiken.                                    1988 hft 284 s.

60575 Anne Morrow Lindbergh: Gåva från havet.                              1956 hft 116 s.

61507 G E Söderholm: Martin Luthers lära om nattvarden,kyrkan,församl. 1936 hft 112 s.

61508 Erkki Tarpila: 65 år fyllda. Ill. av förf.   STOR.                        1976 hft 92 s.

61509 Larin Kyösti (=Gösta Larson): Dikter.  Lite nött pärm.                     1908 hft 170 s.

61514 Amerika bygger. Utställning av amer. byggnadskonst i Ateneum. Ill. 1945 hft 69 s.

61515 Uno Palmström: Bara till graven. Om Olle Lyck.                           1994 poc 208 s.

61516 Resa till Italien 1780,1781,1782. Skrifven 1782 i Stralsund. Utan pärm. 1837 hft 115 s.

61517 Catherina Sinclair: Nutidens talenter eller förståndets utveckling.          1869 pb 337 s.                         

61521 Robert Lacey: Majesty. Elisabeth II and the house of Windsor.  Ill.    1977 poc 416 s.

61522 Gustave Flaubert: Salammbo´.   På svenska.                          1965 poc 309 s.

61524 Cecilia Cidenbladh: Apotekare Brandts sista år.                      1976 klb 139 s.

61526 Carl-Göran Ekerwald: Silkessnöret.                                       1980 kart 126 s.

61527 Britta Munk: Hanne och hotelltjuven.                                        1954 pb 87 s.

61528 Sture Källberg: Uppror-Budapest 1956.    Dagboksblad.        1966 poc 150 s.

61532 Fiskefrämjandets årsbok: Fiske 1961.    Ill.                            1961 hft 238 s.

61533 Sven Green: Min trädgård 1979.   Rikl.ill.                                1978 kart 96 s.

61534 Janne Olsson (red): Jägarens årsbok 1990.   Rikl.ill.                       1989 pb 100 s.B

61537 ”Mein Kampf”. Bilddokumentation nach Erwin Leisers Film.     1961 poc 204 s.

61538 Owe Husahr: Tre hjältar.                                                            1959 inb 237 s.Op

61541 Sven-Erik Klinkmann: Motpunkter och möteslinjer. Tillvarons enhet. 1984 hft 105 s.

61544 E Scott Fitzgerald: Den store Gatsby.                                      1974 poc 205 s.

61545 Gunter Wallraff: 13 icke önskvärda reportage.                         1973 poc 214 s.

61548 Dr med dr fil. Johannes Kuhl: Kost mot kräfta.                        1966 hft 142 s.

61552 Jon Ur Vör: Blåa natten över havet.  Dikter fr. Island.             1976 hft 64 s.

61553 Anna Wahlenberg: En spion.                                                  1926 hft 151 s.

61554 Peter Hays: Den nya psykiatrin.                                            1966 poc 249 s.

61555 Ann & Marianne Fredriksson: De elva sammansvurna.           1997 poc 142 s.

61557 Golda Meir: My life.                                                              1975 poc 396 s.

61559 Märtha Nickul: Altarlågan.  Fragment ur livsöden.                   1955 hft 142 s.

61562 Britt Martiin: Meditation för dig. Lös upp stress med TM.  Ill.  1977 poc 103 s.

61565 Hermann Hesse: Stäppvargen.                                               1968 poc 195 s.

61566 Nils Hallbeck: Sexvarianten.     Ill.                                          1967 poc 160 s.

61567 Joseph Swanson: Svensk-amerikansk Olla Podrida. Humoresker. Förf. ded.1929 hft 154 s.

56170 Erik Petren: Att förstå människor.                                           1956 hft 212 s.

61572 Sten Lundberg: Tyskland under hundra år. Fr. Bismarck till Brandt. 1970 poc 244 s.

61573 H W Armstrong: The United States and Britain in prophecy. Ill.      1980 hft 192 s.

62503 Olly Donner: Varför inte.  Essäer.                                               1959 hft 60 s.

62504 Lolan Björkman: Dagar av blod och eld.  Ill. dikter.                       1983 hft 56 s.

62506 Sedan dess har jag varit här hos er.  Isländska noveller.               1990 hft 134 s.

62507 Gunnel Beckman: Tillträde till festen.  Roman.                         1969 inb 123 s.Op

62508 Maija Nyman: Undret. Dagbok under nio månader.                     1984 hft 128 s.

62510 A P Franklin: Schismen inom pingströrelsen. Vem bär ansvaret ?      1930 hft 74 s.

62511 Elisabeth Bernander : Swahili.   Språklärobok.                        1969 hft 80 s.

62512 En liten bok om preventivmedel.  Rikl.ill.                                  u å   sft 44 s.

62514 G M Linden: Mellanskolans exempelsamling i algebra.               1900 pb 119 s.

62515 R J C Harris: Vad är cancer ?   Ill.                                         1966 poc 160 s.

62519 Våra brev. En modern brevställare.                          Ill.              1961 hft 63 s.

62521 Stockholmsdjäknar och södralatinare. Historik. Ill.                       1955 hft 135 s.

62522 Gustav Björkstrand: Sången och det levande ordet.                        1979 hft 87 s.

62523 Charles von Horn: Tysta patrullen.                                                 1949 pb 127 s.

62528 Stig Kankkonen: men eftersom.  Dikter.                                           1979 hft 70 s.

62529 Maria Nyström: Även vallpojken kan bliva hemmansägare. Betrakt. 1914 hft 64 s.

62531 Edward Andersson: Inledning till skatterätten.                          1987 hft 175 s.

62537 Elisabeth Koch:Hemträdgården./Björn Lindberg:Vårbeskärning av fruktträden.1940 hft 176 s.

62538 Sven-Erik Klinkmann: Drömmen och floden.  Dikter.                         1985 hft 59 s.

62539 Sigrid Juselius stiftelse: Juselius-mausoleet.  Ill.                              1962 sft 24 s.

62541 Erik Johansson: Pojken på landsvägen. Luffare på 30-talet.              1979 hft 158 s.

62549 S A Andree: Minnesalbum.   Ill.         Nött pärm.                              1931 hft 56 s.

62552 Olof Andersson: Att plocka svamp. 67 svampar i ord o bild.          1975 minipoc 80 s.

62553 Källan 1-2004: Johan Ludvig Runeberg 200 år.                      Ill.              sft 84 s.

62555 Mary-Ann Gröhn (red): Jag vaknar upp och tror att jag är i Borgå.       2004 sft 52 s.

62556 Rodrigo Moynihan: Goya. The faber gallery.  STORT album.             ui å   hft 24 s.

62559 Gurli Linden: Framtid.                                                                                        1989 hft 77 s.

62563 Bert. Gunnermo: Till kärleken.  Diktantologi.                         1967 pb 118 s.

62564 Aarne Salokangas: Handledning i svinskötsel.  Rikl.ill.                      1939 hft 102 s.

62565 Borgå merkonomer: Skattekalender 1965. Borgå stad,landskom,Sibbo.    sft 160 s.

62566 Erich von Däniken: Tillbaka till stjärnorna. Argument för det omöjliga.1975 poc 175 s.

62567 Peter von Martens: Gamle vän.  Berättelser.                           1963 hft 170 s.

62569 Rickard Fuchs: Säg aah ….Den konstiga konsten att vara läkare. Ill.    1976 hft 167 s.

62572 Jawaharlal Nehru: Glimtar ur världshistorien.                                       1965 poc 324 s.

62574 ICA provkök: Gott för hemmakväll.   Rikl.ill.                                  1971 hft 125 s.

64501 David Mendell: Obama – from promise to power.   Ill.                   2008 poc 406 s.

64502 Bertil Schutt: En skuggboxares memoarer.                            1972 hft 141 s.

64504 Colin Simpson: Bågskyttarnas djungel.  Fr. Nya Guinea. Ill.         1957 pb 288 s.

64505 Tove Ditlevsen: Man har gjort ett barn illa.                               1949 hft 240 s.

64506 Sören Lindgren: Abals död.   Dikter.                                              1959 hft 47 s.

64507 Nils Bonn: Eko från byn.  Kåserier om Österbotten på 70-talet. Ill.      1981 hft 134 s.

64508 Johannes Linnankoski: Flyktingarna.                                               1955 inb 142 s.Op

64511 Maja Lundgren: Mäktig tussilago.                                                    2010 poc 156 s.

64512 William Bonnor: Världsalltets expansion.   Ill.                                  1965 poc 211 s.

64513 Richard Hill (coll): Have you heard this one ? European jokes.           2000 hft 125 s.

64516 Mayne Reid: Genom Afrikas urskogar.                                            1927 hft 160 s.

64517 Erna Ingo: Ung längtan.  Dagbok 1912-21.                                       1976 hft 134 s.

64518 Gun Nygren: Trädmammans famn.  Dikter.                       1984 hft 58 s.

64522 Månadsjournalen nr 5-1996: Carl XVI Gustaf om Silvia,plikten o lusten.   hft 130 s.

64523 M B Goffstein: En konstnär.  Med färgill.                                   1980 kart 30 s.

64525 Amos Andersons konstmuseum: Felix Nylund. Skulpturer,målningar.1965 hft 40 s.

64527 Erkki Lappalainen: Jag ville så gärna säga det.  Dikter.                    1975 hft 90 s.

64528 Francis Bull: Världslitteraturens historia.                            1962 poc 325 s.

64529 Folke H Törnblom: Mozart. Köchel 1 –626.                                 1971 poc 254 s.

64530 Amanda Kerfstedt: Bland fält och fångar.                                 1922 hft 162 s.

64531 La vie de Jean-Baptiste Bernadotte.   Rikl.ill.                                  1966 hft 50 s.

64532 A Bugge & F Scheel: Liste over dem som betalte leding i Trondheim 1548.1917 hft 35 s.

64533 Bernt Mårtensson: Den röda jorden. En sång om Tanzania.                      1977 hft 60 s.

64534 Olof Thorborg: Fasteboken. Hur man fastar för hälsa o slankhet.                      1956 hft 80 s.

64535 International: Målning av fiskefartyg.  Rikl.ill.                                    u å sft 20 s.

64536 Oskar Vangerow: Papier als Malgrund. Text+ provbitar av olika papperskvaliteter. Sft 23 s.

64538 Hans Zbinden: Albert Anker.  32 s. tysk text + 32 s. ill.                      1943 hft 64 s.

64541 Pauli Välimäki: Ekoköparen. Guide för naturfärd till närbutiken.        1995 hft 148 s.

64543 Lars von Haartman: Vinterljus.   Dikter.                                  1977 hft 67 s.

64545 Harry Lindqvist: Hur gör man livet ljusare ?                                1944 hft 143 s.

64547 Lennart Odlander: Mellan måne och pagod.  Ill. dikter.                      1957 hft 42 s.

64548 Margaret Haikola: Vidare – trots allt. Tankar kring sjukdom o död.      1983 hft 125 s.

64552 Helmer Linderholm:Den röda strömmen.Indianliv i 1700-talets Amerika.1977 pb 157 s.

64553 Gösta Wrede: Bön i dag.  Dikter.                                               1984 hft 63 s.

64554 Leonid Andrejev: En berättelse om sju hängda.                           1946 hft 140 s.

64556 Moderna museet: Klassisk konst i alla hem.  Rikl. sv.v. ill.+texter.    1959 spiral 40 s.

64558 T Oguz: Commercial amphoras of Bodrum museum of underwater archeology. 1995 hft 128 s.

64559 Eva-Stina Byggmästar: Spiralens form.   Dikter.                                  1988 hft 38 s.

64562 Källan nr 3-2001: Lars Huldén 75 år.  Ill.                                             sft 48 s.

64563 Irja Kilpeläinen: Att lyssna och hjälpa.                                       1971 hft 206 s.

64569 Arturo Barea: Smedjan.  Spansk roman.                                         1965 poc 300 s.

64570 Uno Modin: Robban och jag.                                                           1969 pb 136 s.

64573 Ulla Kivimäki: Aromaterapi och eteriska oljor.                                1994 sft 33 s.

64575 James Fenimore Cooper: Skinn strumpa.              Ill.                      1936 pb 198 s.

65501 Gunnar Ahlström: Den underbara resan.   Nils Holgersson.                1942 poc 198 s.

65502 Tryggve Lindén: Sankt Hemmings ikonografi.  Ill.                              1955 sft 8 s.

65504 Eugen Roth: Das schönste von Munchen.  Ill.                                    1954 pb 48 s.

65505 Olle Hedberg: Då bleknar bruden.                                                     1955 poc 240 s.

65506 Sv. turistföreningen: Fjällturer i Lappland.  Ill.                                    1954 hft 482 s.

65507 Pierre Marot: Le pays de Jeanne d´Arc.  Rikl.ill.                                1962 hft 64 s.

65508 K-G Hildebrand & Britt G Hallqvist m.fl.:Böner i vår tid.                    1969 klb 169 s.

65510 Länsförsäkringsgruppen: Den lokala historien.80 år av framg.rikt samarbete.1997 hft 65 s.

65511 Bengt af Klintberg & Finn Zetterholm: Svensk folkpoesi.                    1971 poc 309 s.

65514 Eyvind Berggrav: Nathan Söderblom. Geni og karakter.                     1931 hft 89 s.

65516 D Buenner: Notre-Dame de la mer esles Saintes-Maries. Rikl.ill.          u å  hft 40 s.

65517 Thielska galleriet: Katalog och historik.  Rikl.ill.                                  1960 hft 66 s.

75518 Adolf Svahn: Husaby.  Rikl.ill.                                                          1972 hft 44 s.

65521 Longos: Daphnis och Cloe.  En herderoman. Ill.   Med förstreckn.      1959 hft 126 s.

65524 Sixten Strömbom: Att se på konst-att förstå konst.  Rikl.ill.                 1948 sft 47 s.

65525 Alf Agdler: Händige man med tips till tusen.  Ill.                                 1973 poc 117 s.

65526 Robert S de Ropp: Sexualiteten en naturkraft.  Ill.                              1971 poc 217 s.

65527 Röster,vägar.   Ny österbottnisk lyrik.                                                1972 hft 111 s.

65529 Olof Lagercrantz ( urv): Dikter om mor och barn.  Ill.                        1945 pb 53 s.

65530 Yasunari Kawabata: Kyoto eller De unga älskande i den gamla kejsarstaden.1969 poc 215 s.

65531 Shakespeare: The Tempest. Ed.: A W Verity. På engelska.                1951 klb 168 s.

65532 Sophokles: Kvinnorna från Trachis. Tolkn.:E Zilliacus.  Med förstreckn.1957 hft 116 s.

65536 Hans Magnus Enzensberger (red): Studenterna och makten.               1968 poc 232 s.

65538 Rolf Sandqvist: Fjärilsväg.  Ill.                                                           1947 hft 72 s.

65541 Emil Zilliacus: Templet. Kantat vid Åbo Akademis doktorspromotion 1927 sft 16 s.

65542 Hugo Perls: Varför är Camilla vacker ? Om konst,konstnärer o konsthandel.1965 poc 225 s.

65544 FIB:s lyrikklubb: Fransk poesi 1910-70. Ill.                                         1973 poc 235 s.

65545 Metropolitan popular season – spring 1936.  Rikl.ill. programhäfte.             Sft 20 s.

65549 Källan nr 2 – 2010. Tema: Tidig finlandssvensk litteratur.  Rikl.ill.                hft 62 s.

65550 Gurli Lindén: Framtid.                                                                       1989 hft 79 s.

65553 Sun Axelsson: Väktare.                                                                    1963 hft 142 s.

65555 Bengo Malmsjö: På tal om 70-talet.                                                   1981 hft 73 s.

65556 Bonniers konstböcker: Renoir.  Rikl.ill.                                              1953 hft 60 s.

65557 Lilla bilatlasen – Sverige.                                                                  1977 spiral 50 s.

65559 Sven-Olof Rosén 1908-82.  En minnesutställning.   Ill.                        1984 sft 12 s.

65561 Tirukkural. Sydindisk levnadsvisdom.                                           1971 poc 162 s.

65562 Mikko Raatikainen m. fl.: Ogräs och ogräsbekämpning.  Rikl.ill.          1971 hft 108 s.

65563 Sture Lagercrantz: Slagnätet.   Ill.          Med förf. ded.             1933 hft 15 s.

65565 Sven-Erik Klinkmann: Drömmen om floden.  Dikter.                       1985 hft 62 s.

65567 Nils Afzelius: Myt och bild.  Studier i Bellmans dikt.                     1964 hft 140 s.

65571 Unibet: Poker ABC.  Rikl.ill.                                                       u å   hft 60 s.

66504 Jarl Brommels: Österbottnisk folkhälsa 1955-85.  Ill.                      1985 hft 63 s.

66505 Christina Cleve: Prins Wilhelms konst.   Ill.                                 1961 hft 105 s.

66507 Margareta Lindblad m.fl.: Phuket – Krabi.    Ill. guide.                  2000 hft 158 s.

66512 Lars M Boström: Blommor jag plockat..  Dikter.                           1940 hft 54 s.

66514 Corinne Hofmann: Den vita masajens dotter.   Ill.                      2005 poc 188 s.

66516 Märtha Nickul: Brutna rosor.   Dikter.                                1921 hft 95 s.

66518 Graham Greene: Doktor Fischer,Geneve eller bombpartyt. 1981 poc 188 s.

66519 Christina Lööf: Gränser.                                                  1963 hft 95 s.

66521 Nurnberg des Deutschen Reiches Scharkästlein.    Ill.     u å   hft 109 + XVIII s.

66524 Anne Holt: Blind gudinna.  Kriminalroman.                       1997 poc 350 s.

66528 Tom Sandell: Ägg och nejlika.    Dikter.                       1957 hft 69 s.

66529 Stig Claesson: Sanningen och ingenting annat än.         1979 poc 171 s.

66530 Martin A Hansen: Lögnaren.                                              1951 hft 163 s.

66532 Donna Leon: Död i främmande land.  Deckare.                       1997 poc 309 s.

66535 Birgit Cullberg: Baletten och vi.  Rikl.ill.                       1965 poc 120 s.

66539 Sissela Bok: Alva (Myrdal) – ett kvinnoliv. Ill.              1988 poc 222 s.

66542 Henrik Ibsen: Peer Gynt.  Dramatsik dikt.                          1991 poc 222 s.

66546 Chuang tzu: Äkthetens urkund.    Kinesisk dikt.                    1964 inb 83 s.Op

66552 Bent Larsen: Du måste ha en plan.  Prismas schackskola 2. Ill.     1977 hft 66 s.

66557 Lolan Björkman: Sekunder av klarhet.   Dikter.            Ill.            1976 hft 53 s.

66559 K W Gullers: USA – Sweden.   Rikl.ill.                                       1969 hft 80 s.

66562 John M Allegro: Dösahavsrullarna.  Ill.                                      1963 poc 159 s.

66565 Ragnar Numelin: De tavastländska sjöarna och Näsijärvi-området.Ill. 1927 hft 69 s.

66566 Paulo Coelho: Veronika bestämmer sig för att dö.  Filmad.          2010 poc 285 s.

66570 Torsten Steinby:En finländsk Grand Tour genom Europa 1834-35.Ill. 1986 hft 98 s.

68502 Markus Adolf Schaffner: Barnlek och leksaker.                                 1946 hft 77 s.

68503 Carl-Johan Clemedson – Arne Nelson: Atomvapenskador.                 1956 inb 160 s.Op

68505 Bonniers konstböcker: El Greco.   Rikl.ill.                                          1953 hft 80 s.

68506 Knut Weibust: The crew as a social system.  Om sjöfolk. Ill.              1958 hft 66 s.

68509 Båtutställningen Allt för sjön 1977. Älvsjö,Stockholm.                                 hft 121 s.

68510 Kaarina Jousimaa: Finland- a scandinavian modern country. Rikl.ill.    1978 hft 78 s.

68511 Bernt Bergström: Maskros och korstecken.   Dikter.                          1960 hft 62 s.

68513 Skrivarkluben Pennan: Falköpingspennor 2000. Ill.                                      sft 52 s.

68515 Gits Olssons bästa: Morfar i täten.  Ill.                                               1983 hft 126 s.

68518 Berlitz´ reseguide: Mallorca och Menorca.  Rikl.ill.                               u å  hft 129 s.

68519 Berlitz reseguide: Kanarieöarna.  Rikl.ill.                                             u å  hft 129 s.

68520 Carl Hammarén: Fritt ur hjärnan.  Aforismer.                                    1975 kart 45 s.

68521 Uriel Hedengren (urval): Världens bästa citat.                                   1987 kart 112 s.

68523 Gunvor Anér: Värmlandsvers.  Dikter.                                              1977 hft 59 s.

68526 Medlemsförteckning för svenska sektionen av AICH 1953-71.(Cap Horn). sft 18 s.

68527 Stig Claesson: Att resa sig upp och gå.                                              1979 poc 155 s.

68530 Skeninge. En liten stad med stora minnen.   Ill.                                   1950 sft 46 s.

68531 Herman Stolpe: Arabiska ordspråk och visdomsord.                           1979 kart 83 s.

68532 Jan de Hertog: Segelfartyg.  Rikl.ill.                                                  1984 kart 48 s.

68537 Thielska galleriet , Stockholm.  Sv.v. o färgill.                                    1961 hft 70 s.

68539 ICA-Kurirens lördagsgodis.  Rikl.ill.                                                  1962 hft 67 s.

68540 Bläckhornet årg. 12: Östergårdsblommor. Poesi o prosa i Sventorp.    2004 sft 50 s.

68541 Gallen-Kallelas Tarvaspää.   Museum guide.  Rikl.ill.                         1972 sft 20 s.

68542 Din bok kära vän. Ord om livet och kärleken. Ill.: Birger Lundquist.    1986 poc 115 s.

68543 BJ W Hill: The history and treasures of WINSDOR CASTLE. Rikl.ill. u å  sft 32 s.

68544 Harry W Blackburne:The romance of St Georges chapell-Windsor castle.1958 hft 90 s.

68545 R S Newall: Stonhenge-Wiltshire.  Ill. + karta.                                   1955 sft 24 s.

68546 Maj-Britt Eriksson: Melodi på nyckelharpa.                                        1956 hft 124 s.

68549 Nils Sundquist: Upplands kyrkor 99:Danmarks kyrka.  Ill.                   1972 sft 30 s.

68550 Östasiatiska museet – Bildkatalog.                                                    1963 hft 104 s.

68556 Vilhelm Moberg: Brudarnas källa.  Fr. Ekekullen.                               1963 poc 134 s.

68557 Natanael Beskow: Till de unga. Tankar o råd i livsfrågor.                   1910 klb 113 s.

68558 Visby och Gotland i färgbilder.                                                          1962 hft 36 s.

68559 Martinus Laurentii Aschaneus: Beskrivning om Sigtuna. Ill.                1995 hft 67 s.+karta

68561 Oscar Reutersvärd: Impossible figures.  STOR.                                 1981 sft 24 s.

68562 Charlotte Mattsson: Ät gott och bli slank.  Ill.                                     1978 kart 64 s.

68563 Manskören Frihetsbröderna 1905-65.  Ill. historik med medlemsförteckn.   sft 31 s.

68566 August Strindberg: De lycksaliges ö och andra berättelser.                 1914 hft 155 s.

68567 Rafael Gyllenberg: Från advent till allhelgon.                                      1927 klb 141 s.

68568 Klas Råsäter-Åke Magnusson: Ut i skogen !  Naturguide. Rikl.ill.       1983 sft 96 s.

68569 Per Erik Wahlund: Londonpromenader.  Ill.   Lite fläckig.                   1970 poc 235 s.

68570 Kineser. Kinesiska dikter i övers.:Hwang Tsu-Yu o Alf Henrikson.     1952 hft 97 s.

68572 A W Rancken: Kyrkan S:t Katarina i Karis.  Ill.                                 u å   sft 10 s.

68573 Estrid Knuts: Alla tiders bröllopsresa.  Ill.                                          1983 hft 56 s.

68574 Agne Hamrin: Här är Italien.  Ill.                                                      1968 poc 183 s.

68575 Liljevalchs: Sven Erixson.   Rikl.ill.                                                    1961 hft 88 s.

69501 Anita Sjöberg: Bryggan.  Fr. norra Uppland.  Ill.                                1995 hft 83 s.

69506 J P Wallensteen: Ett bondbröllop i Danderyds socken 1786.                1971 sft 26 s.

69507 Program för statens preliminära järnvägsundersökningar 1899. Ill.       1899 hft 35 s.

69511 Stadgar för Postiljonernas i Finland understöds- och pensionsförening. 1912 sft 18+18 s.

69512 Sjöfartsdelegationen: Sjöfartspolitiskt program.                                   1984 hft 49 s.

69513 The Maritime Museum Helsinki: Annual report 1979.  Rikl.ill.                    sft 20 s.

69514 Nat. Beckman : Två finländska gårdsrättsredaktioner.                        1919 hft 46 s.

69515 Konkordia,Förbund för kvinnostipendier.Sextonde årsberättelsen för år 1901.1902 hft 13 s.

69516 O Olander: Näringsfriheten och arbetets framtidutsigter.                Hfrs 1886 hft  40 s.

69517 Förslag till förnyadt Reglemente för Finska Brandstodsbolaget för landet. 1882 hft 31 s.

69518 Finska redskapshandeln P Sidorow,Helsingfors.Första häftet intyg,dels i afskrifter …1890 hft 12+12 s.

69520 Generalag. för Finland Alex. F Lindberg,Hfrs:Hufvud-prospekt:The Mutual Life i New York.

       Lif-,blandade lif- och kapital-,barnutstyrsel-,lifränte- och pensionsförsäkringar.1898 hft 32 s.

69523 Ruben Nöjd: Fransk-svensk ordbok.                                                  1972 hft 121 s.

69524 Friluftskarta: Huvudstadsregionen.  1:45.000.  STOR. Ihopvikt.     1980

69526 Ernst Semmelmans minnen. Utgivna av Hans Alfredson.  Ill.              1962 hft 79 s.

69527 Dale Carnegie:Hur man blir vän med livet och trivs med sitt jobb.        1971 poc 142 s.

69530 ”Crab” Searl: Sailing.    Ill. Handbok.                                                1956 poc 221 s.

69531 Harald Wideen: Skara domkyrka. Kort historik o vägledning.  Ill.        1953 sft 32 s.

69533 Emanuel Kasakevitj: Stjärnan.  Berättelse.                                         1961 inb 93 s.Op

69534 Nordiska konstförbundet: Tre islänsdska konstnärer.  Ill.                     1952 sft 44 s.

69535 Karen Blixen: Babettes gaestebud.   På danska.                                1870 hft 74 s.

69536 Skrivarklubben Pennan,Falköping: Falbygdspennor 1999.  Ill.                       sft 52 s.

69537 Gunvor Anér: Ack Värmeland.   Dikter.                                         1972 hft 61 s.

69539 Skövde turistkarta. Kommunkarta-tätortskarta-gaturegister.                2007

69540 Finlands riksdag: Den representativa demokratins genombrott i Finland. Ill.2006 sft 32 s.

69542 Joel Fridfelt (utg.): Hemåt. Illustrerad kalender 1956.                                 dekklb 112 s.

69544 Amos Andersons konstmuseum: Sigrid Schauman. Ill. STOR.             1968 sft 28 s.

69546 Kurt Högnäs: Glashus.   Dikter.                                                        1972 hft 50 s.

69547 Ivar Ighe & Ewert Åberg: Ogräs på åkern.  Rikl.ill.                           1970 inb 11 s.B

69548 Svenska konstskatter. Fr. äldsta tider till 1900-talets början. Ill            1949 hft 111 s.

69549 Alexander Neverov: Tasjkent-brödets stad.                                       1949 hft 179 s.

69550 Elise Lindgren-Nylund: Sjung sena prästkragar.  Dikter.                     1951 hft 61 s.

69551 Regis Debray & ”Che” Guevara m.fl.:Kontinent i uppror.                  1967 poc 156 s.

69553 Viveca Lärn: Midsommarvals.                                                          1999 poc 250 s.

69554 Aldus världsatlas.  100 s. kartor med 15.000 namn.                            1962 hft 240 s.

69555 Märtha Nickull: ”Som en lilja”.                                                          1938 hft 55 s.

69559 Kerstin Haldin: Reslust.   Dikter.                                                       1981 hft 98 s.

69561 Axel Olsson & Gunnar Torstensson: Jordbearbetning. Åkerbruk. Ill.   1958 sft 59 s.

69562 Ivar Harrie: Athenare.  Essäer.                                                         1964 poc 148 s.

69566 Carl Johan Holzhausen: Gunnar Falkås.Diktare och bonde.                 1976 hft 77 s.

69569 Corinne Hofmann: Den vita massajen.                                               2006 poc 282 s.

69570 Börje Ahlö: I skuggan av ditt leende.  Dikter.                                     1972 hft 53 s.

69573 Karin Brunk Holmqvist: Potensgivarna.                                              2005 poc 198 s.

70501 Erik Blomberg: Naivister och realister.  Konstnärspresentationer. Ill.   1962 poc 110 s.

70503 Bo Edman-Lars Rask: Vi upptäcker Sverige. Geografi. Ill.                 1969 kart 206 s.

70504 Janne Olsson: Sportfiskaren 2007. Rikl.ill.                                          2006 kart 80 s.

70505 Karl-Otto Aly: Hur bör man fasta ?  Ill.                                             1883 sft 24 s.

70506 Hilding Pawlo: Gå in i sin självbild.  Dikter.                                        1983 hft 84 s.

70508 Baedekers Autoreisefuhrer: Hartz – Heide.  Rikl.ill.                           1970 hft 128 s.

70509 Henning Pallesen: De avvikande.                                                      1964 hft 181 s.

70510 Bo Lundmark: Väv utan sömmar. Dikt  o prosa.                                1996 sft 31 s.

70511 Musée du Louvre:  Ècole francaise. Le XVIII siécle.  Rikl.ill.             u å   sft 32 s.

70513 Konstmuseet i Ateneum.   Utländska målningar o skulpturer.              1959 hft 60 s.

70514 Ms språknyckel med motorparlör. Spanska.                                       1967 hft 100 s.

70515 Michelin-guide: Auvergne.  Rikl.ill.                                                    1970 hft 162 s.

70517 Svenska Taxklubben: Drevproven 1978. Domarberättelser.                          sft 85 s.

70519 Gunvor Anér: På kyrkbacken.   Dikter.                                             1968 hft 57 s.

70520 Nationalmuseum,Stockholm: Rembrandt.                                           1956 hft 133 s.

70521 Finska trädgårdsföreningen i Helsingfors:Prisförteckning öfver trädskolealster. 1895 sft 19 s.

70525 Den politiska konflikten. Tal o andra urkunder. Bl.a. bondetåget.         1914 hft 49 s.

70527 Fram,fram bondemän !Minnes- och maningsord till bondetågets ledamöter.1914 sft 48 s.

70528 Sten Vägvisare: Staaff eller kungen ?                                                1914 sft 32 s.

70529 Reglemente för handels-föreningen i Helsingfors stad.                        1881 sft 12 s.

70530 Jarle   Björklund: Folk og sjö gjennom tidene. Rikl.ill.                          1976 hft 125 s.

70531 Christian Ahlström:Arkivforskning och sjöhistoria.Borstövraket. Ill.     1972 hft 20 s.

70532 Nils Gustaf Nilsson: Skeppsmätningen genom tiderna.  Ill.                   1945 sft 10 s.

70533 Birger Lemberg: Mejerihanteringens utveckling i Pernå socken.          1957 sft 47 s.

70534 Veteranposten nr 2 – 2001: Skärgårdshav i vinterskrud.  Ill.                         sft 40 s.

70538 Chr. C Sturm: Morgon- och afton-andakts-öfningar på hwar dag ….   1826 pb 216 s.

70540 Marjatta Herva: Let´s have a sauna.   Ill.                                           1982 sft 22 s.

70541 Carl Hammarén: Med andra ord.   Aforismer.                                   1979 kart 52 s.

70542 Nils Suber: Plocka rätt svamp.  120 svampar i ord o bild.                    1974 hft 143 s.

70544 Manfred Björkquist: Kyrkan kriget och nationalismen.                        1914 hft 46 s.

70548 Carl-Erik Ström: I molnmuseet.  Dikter.                                             1971 hft 54 s.

70549 Leo Huberman-Paul M Sweezy: Den globala kontrarevolutionen.        1971 poc  321 s.

70551 Kring Hjalmar Bergman. Sju författare beskriver.                              1965 poc 235 s.

70554 Ngugi wa Thiong´o: Djävulen på korset.   Fr. Kenya.                         1982 hft 275 s.

70557 Till sjöss.En skildring av fartygens historia genom tiderna. Ill.              u å   sft 48 s.

70558 Bernt Mårtensson: Detta är deras stad.  (=Helsingfors).  Dikter.         1987 hft 58 s.

70560 Mässmusik för Finlands evangelisk-lutherska kyrka.  Med noter.         1969 sft 42 s.

70563 Båtliv 77.   Rikl.ill.                                                                            1977 hft 111 s.

70564 Gunnar I Nylund: Gnistor av liv.  Prosapoesi.                                     1987 hft 39 s.

70565 Irma Karila-Leena Valvanne: Barnet du väntar.  Ill.                           1978 sft 51 s.

70566 Färg AB International: Handbok för hemmamålare.  Rikl.ill.               u å   sft 34 s.

70567 Erik Moltke: Vestsjaellands kirker.  Rikl.ill.                                        u å   kart 96 s.

70568 Zoe Myrman: Nattskärran. Dikter.                                                    1953 hft 99 s.

70569 Oguz Alpözen: Bodrum.Ancient Halicarnassus. Official guide.            1972 hft 130 s.

70571 Gust. Lindberg (utg): Muhrs brukskatekes.                                        1967 hft 46 s.

70572 Falstaff , fakir.  Urval: Tage Nilsson.                                                 1961 poc 166 s.

70575 Tomas Mikael Bäck: Frågare !       Dikter.                                        1988 hft 50 s.  

72501 Konstitutionella förbundets valbok mars 1914.  Lite understreckn.       1914 hft 89 s.

72502 Julius Sellman: Konungen och hans rådsherrar.                                  1914 sft 20 s.

72503 Torsten Edgren (red):The maritime museum of FinlandAnnual report 1989-90.sft 96 s.

72504 John Lundberg: Handledning i användandet af rundresebiljetter ….       u å  hft 40 s.

72508 Professor J Thyrén: Sjöförsvarets betydelse för Sverige.                    1911 sft 24 s.

72509 Sigurd Sahlberg: Husdjurslära.   Ill.                                                    1957 pb 131 s.

72511 V Fedynsky: Meteors.   Ill.                                                                1959 hft 125 s.

72512 Kapten S Dehlgren: Slaget vid Horns Rev.  Med kartor.                     1916 hft 59 s.                

72517 Nils Kristofferson Humble:Strömmingsfisket i Roslagen. Fr. 1745.      1982 hft 34 s.

72518 Juhani Rekola:Finnar i medeltidens Stockholm/Karelare i Sverige.       1986 sft 16

72520 Lars Åke Kvarning-Bengt Ohrelius: The swedish warship WASA.Ill. 1973 sft 36 s.

72523 Hans Alfredson: En ond man. Ett slags roman.                                  1986 poc 180 s.

72525 Diogenes-böckerna: Humor. Det handlar om musik.      Ill.                 u å  pb 73 s.

72526 Maj-Britt Eriksson: Ofelia från Dalarö.                                              1972 poc 94 s.B

72530 Preben Eider: Costa Brava.   Ill. guide.                                              1970 hft 156 s.

72532 Leif Panduro: Vägen till Jylland.                                                        1978 poc 139 s.

72535 Svenska taxklubben: Drevproven 1979. Domarberättelser.                          sft 90 s.

72536 Gösta Ågren: Bergvägg.   Dikter.                                                      1959 hft 51 s.

72537 Åke Färnlöf: När,var och hur bör man fasta ?   Ill.                             1988 sft 23 s.

72539 Ivan Einarson: Livets melodier.   Dikter.                                            1934 hft 58 s.

72541 Sivar Ahlrud: Cirkus Babbini.  Pojkdetektiverna.                                1945 pb 126 s.

72542 Klassisk konst i alla hem: Barnbilder. Ur Nationalmusei samlingar.      1950 spiral 80 s.

72543 D O Harvey: Yachting and boating book of navigation.  Ill.                 1956 poc 160 s.

72544 Mikael Wahlforss:Den svarta vägen. Dikter fr. tre krig i Centralamerika.1982 hft 64 s.

72545 Sven Delblanc: Åminne. En berättelse från Sörmland.                        1978 poc 218 s.

72546 Nils Nilsson 1901-49.  Ill. konstnärspresentation.                                1975 sft 32 s.

72547 Nancy Eriksson: Bara en hemmafru. Inlägg om kvinnan i familjen       1964 sft 62 s.

72550 Lars Järlestad: Ett annat ansikte.     Dikter.                                       1986 hft 60 s.

72553 U R Finnäs: Historik. Esse kommun 1865-1965.  Ill.                           1965 sft 22 s.

72554 Sundsvalls museum: 22 grafiker kring Hasse.  Rikl.ill.                         1984 sft 32 s.

72555 Anita Wikman: Därför.  Dikter.                                                        1977 hft 51 s.

72556 Georg Klein: Pietá.   Essäer.                                                             1990 poc 297 s.

72558 Hans Mörk: Porträtt i träram.    Noveller.                                          1958 hft 147 s.

72559 Christian Houkjaer: Lars Kruse – ein Retter aus Skagen. Ill.               u å  sft 10 s.

72560 Jose M Castellano m.fl.:History of the Canary Islands.  Ill.                 1993 hft 152 s.

72563 Nils Westermarck: Lantbruksekonomiska utblickar.                           1975 hft 76 s.

72564 Sten Andersson: Positivism kontra hermeneutik.                                 1979 hft 119 s.

72565 Alfred J Zaehringer: Sovjet i rymden.   Ill.                                         1961 poc 170 s.

72566 Dick Karlsson: Binära speglingar.  Dikter.                                         1986 hft 84 s.

72568 G de Purucker: Gyllene föreskrifter i forntida visdom.                         1950 klb168 s.

72569 Matti Bergström: Barnet – den sista slaven.   Ill.  Med förf. ded.       1991 hft 88 s.

72570 Åke Gulin: Julivandring.  Dikter.                                                        1965 hft 84 s.

72571 Björn von Rosen: Samtal med en nötväcka.  Ill. av förf.                      1978 poc 90 s.

72572 Paul von Martens: Mannen som byggde en båt.  Förf. debut.              1977 hft 114 s.

72574 Hjärnslag. Undersöknings- och vårdprogram.   Ill.                              1981 hft 92 s.

73501 Ulla-Christina Sjöman: Nära Herren.                                1979 hft 120 s.

73503 C G Hartman: Upplyst farled.   Fr. fjärran land.  Ill.           1960 hft 91 s.

73504 Bosse Larsson: Allsånger 3.  24 allsånger från Skansen.      1984 sft 40 s.

73505 Hans Mörk: Svansången.  Noveller.                                   1959 hft 118 s.

73507 Juhanni Rinne: Åbo domkyrka. En byggnadshistorisk vägledning. 1929 sft 36 s.

73508 Sam J Lundwall: Alice,Alice ! Science-fiction.                    1974 poc 151 s.

73510 Sune Lindqvist:Svenskarna i heden tid. Ill  Blad 113/114 saknas. 1935 hft 264 s.

73511 Emil Forsander: Förberedande kurs i geografi för folkskolor. Rikl.ill.  1902 pb 29 s.

73512 Gullers-Pers: Sverige-USA. Fakta,bilder,tankar kring förbindelserna. 1969 hft 80 s.

73514 Allmänna valmansförbundet: Politisk valhandbok Nr 1- 1914.      1914 hft 144 s.

73515 Bo E Åkermark (red): Drömmen om Orientexpressen.             1974 poc 204 s.

73516 J W Hamner: Visby. En vandring i minnenas stad.  Ill.            1914 hft 64 s.

73517 Giuseppe Verdi: La Traviata. Vollständiges Operbuch.            u å  hft 80 s.

73518 Henrik Stangerup: Det är svårt att dö i Dieppe.                      1988 poc 306 s.

73519 Indianer och cowboys:Ser. B 18: Banditdrottningen.     Ill.       1907 hft 60 s.

73521 Åke Gulin: Bildvävnad.   Dikter.                                            1956 hft 84 s.

73522 Margaret Haikola: Från tankens örtagård.  Med vinj. av förf.  1987 hft 99 s.

73524 Michelin-guide: Gorges du Tarn:Cevennes-Bas Languedoc.  Ill.   u å   hft 96 s.

73525 Silverfloden. Tusenårig japansk lyrik i tolkn. av Lotti Jeanneret. Ill. 1960 hft 103 s.

73528 Levi Sjöstrand: Utlämnad.                                                       1973 hft 146 s.

73529 James Baldwin: Nästa gång elden.                                          1963 hft 127 s.

73531 Åbo stads historiska museum-häfte VII-1910. Stenåldersredskap,Per Brahes porträtt,stolar.  hft 24 s.

73532 Ernst Brunner: Känneru brorsan ?                                          1994 poc 214 s.

73534 Eric Lundqvist: Djungeltagen.                                                1954 pb 246 s.

73537 Elisabeth Tham (red): Köksalmanack 1981. Rikl.ill.                        pb 211 s.

73538 Peter Nilson: Arken.                                                            1984 poc 305 s.

73540 ICA provkök: Bekväm mat. Lätt och gott. Ill.                        1970 hft 96 s.

73541 Brunnhages förlag: Björn-tennisspelaren. Med Björn Borgs tennisskola.1973 hft 111 s.

73545 Föreningen Svensk elitfotboll: Elitfotbollen 1989.  Rikl.ill.                hft 130 s.

73547 Henrik Lindeberg: Vad jag hört och sett.   Fr. Sjundeå.  Ill.     1993 hft 64 s.

73549 Axel Hambaeus: Legender.                                                 1965 poc 137 s.

73553 Aldous Huxley: Geniet och gudinnan.                                   1956 hft 127 s.

73555 Gudrun Sandström: Lergök.   Dikter.                                   1949 hft 93 s.

73556 Nalle Valtiala: Varning för människan.                                1970 hft 151 s.

73558 Rickard Fuchs: Visst är ni sjuk !  Handbok för hypokondriker. 1976 poc 158 s.

73560 Inger o Hans Joakim Schultz: Turen går till Greklands öar.  Ill. 1977 poc 122 s.

73561 Richard Gordon: Sir Lancelots fiskafänge.                              1966 hft 194 s.

73563 Hans Fors: Lysaren.       Dikter.                                            1975 hft 91 s.

73565 Reumatoid artrit.  Undersöknings- och vårdprogram.    Ill.      1982 hft 154 s.

73566 Helge Jedenberg: Förundrans dikter.                                     1976 hft 75 s.

73567 Diana Bredenberg: Rast.  Dikter.                                        1988 hft 92 s.

73570 Lennart Rudström: Lillo och hunden.  Rikl.ill.                        1965 pb 60 s.

73571 Allan Petre: Friluftsliv.  Vägledning för vistelse i skog o mark. Ill. 1932 hft 128 s.

73572 Ulla Sid: Jag förstår mej inte på Lulu.                                   1974 hft 128 s.

73573 Jaquetta Hawkes: Vi på jorden. En bok om människans väg.  1957 hft 204 s.

73574 Göran Tunström: Maskrosbollen.                                          1966 poc 172 s.

73575 Bengt Holmqvist: Tretungad halvö. Tio feriebrev fr.Chalkidiki. Ill. 1977 hft 77 s.

74501 Johan Lindahl: En fiskarpojkes UTÖ. (I Sthlms skärgård). Ill.             1976 poc 88 s.

74502 Statens sjöhistoriska museum –National maritime museum. Guide.      1953 hft 48 s.

74503 Jan Erik Nilsson m.fl.: Ostindienfararen Götheborg. Rikl.ill.                 1992 hft 58 s.

74506 Rune Pettersson: Kapten på klipperskepp. Diktsvit.                            1979 hft 60 s.

74507 Birger Nerman: Tiotusen år i Sverige I: Forntiden.                              1947 hft 42 s.

74508 J E Rosberg: Travels in Finland.   Ill.                                                 1920 sft 24 s.

74510 G S Laird Clowes: Sailing ships. Their history and development. Ill.     1962 hft 95 s.

74511 Några ord i Öresundska lotsfrågan af en svensk f.d. diplomat.            1874 hft 51 s.

74512 Arlanda-inrikes. Från vision till take off.  Rikl.ill.                                1984 sft 58 s.

74514 Turistföreningen i Finland: Turistliv. Bildalbum.                                  1938 hft 64 s.

74515 Björn Collinder: Finska Tornedalsbekymmer.                                     1923 hft 8 s.

74516 Gustaf Hellström: Snörmakare Lekholm får en idé.                            1949 pb 351 s.

74517 Georg Borgström: Gränser för vår tillvaro. Jord,vatten.skog …           1969 poc 324 s.

74518 Tidens kalender 1979.  Med många artiklar.  Ill.                                     inb 252 s.Op

74520 Rolf Lindberg-Rune Sternberg: Sportfiske 66.  Rikl.ill.           hft 110 s.

74521 Doct. M Luthers Lilla Katekes. Förslag .. utaf första finska kyrkomötet.1881 pb 45 s.

745212 Katekes för Evangelisk-lutherska kyrkan i Finland.                        1956 pb 108 s.

74523 Ivar Wallensteen: Kvickt och tänkvärt. Citat.                                     1984 pb 62 s.

74527 Alfred Hitchcocks mysterimagasin nr 1-april 1964.                                    sft 79 s.

74528 Alfons Sundqvist: Fria kristliga folkhögskolan läsåret 1945-46.                    sft 15 s.

74530 AlanLoy McGinnis: Kärleksfaktorn..                                                 1988 kart 192 s.

74531 August Strindberg: Fadren / Fröken Julie.                                          1970 poc 114 s.

74532 Trollhättan. Fotoalbum av Th. Nilson.  ”Dragspel”, 10 sv.v. bilder.      Ca 1890 hft

74533 Gunnar E Sandgren: (red) Jägaren 1993-94. Viltet-vapnen-hundarna.  1993 hft 142 s.B

74534 Johan Ludvig Runeberg: Julqwällen. En dikt i tre sånger.                    1901 pb 51 s.

74535 Hermann Hesse: Siddhartha. En indisk berättelse.                              1968 poc 123 s.

74536 Georg Nordensvan: Lek.  Novelletter.                                               1887 hft 203 s.

74537 Einar Knutsson: Rakt in i äventyret.                                                  1955 pb 126 s.

74538 The maritime Museum,Helsinki: Annual report 1979. Bl.a. Rääkkylä,Larsmo,Jussarö sft 20 s.

74539 Ljus. Kristlig kalender 1911. Bl.a. H Råbergh: Aurore Karamzin.                dekklb 165 s.

74540 Antoine de Saint-Exupéry: Kamrater på en irrande planet.                  1964 poc 200 s.

74544 Elisabeth Tham (red): Köksalmanack 1979.     Tejpad rygg.                         pb 213 s.

74545 Helge Jedenberg: Ljusets nionde,den ofullbordade.  Dikter.                 1978 hft 45 s.

74549 Harald Wollstad: Sjukjournal.    Fr. Ljungskile.                                   1968 hft 100 s.

74550 Gunlög Järhult: Så är det då att vara människa.                                  1975 inb 233 s.Op

74551 Olivia. Av Olivia.                                                                             1949 hft 158 s.

74552 Torgny Lindgren: Ormens väg på hälleberget.                                    1983 poc 153 s.

74553 Åke Gulin: Höståker.     Dikter.                                                        1954 hft 102 s.

74554 Levi Sjöstrand: Nyårsafton.                                                              1976 hft 152 s.

74555 Viktor E Frankl:Livet måste ha en mening.Koncentrationslägerfånge.  1973 hft 133 s.

74556 Ulf Gustafsson: Det kunde vara du.                                                   1981 hft 133 s.

74558 Dorothy Parker: Levande begråtna.   Noveller.                                  1965 poc 135 s.

74559 Hans Edvard Teglers: Vad väntar vi på ? Drömmar,samvete,karriär.   1967 hft 131 s.

74562 Eva Rosas: Bianca och vi.   Ill. hundbok.                                           1984 hft 95 s.

74563 Carl Milles. Millesgården Lidingö 1972.  Ill.                                                 hft 35 s.

74564 Hans Gilbertson:Insjöpojken som blev Sydindiens apostel.Om A J Hedén.1954 hft 56 s.

74565 Milan Kundera: Varats olidliga lätthet.      Filmad.                              1991 poc 347 s.

74566 Cora Sandel: Alberte och friheten.                                                    1948 poc 297 s.

74568 Edward S Ellis: Bakhållet vid Ohio. Nybyggarliv i Kentucky. Ill.          1900 pb 188 s.

74569 Ellery Queen´s kriminalpocket nr 1.                                                   1968 hft 98 s.

74570 Kjell Andersson: Svamparnas värld. Ett spännande stycke ekologi.      1977 hft 47 s.

74571 Renzo Modesti: Modigliani.  Stort konstalbum.Engelsk text.                u å   hft 32 s.

74574 Damon Runyon: Pysar och sländor. Brodways glada 20-tal.                1963 poc 175 s.

74575 Statens institut för konsumentfrågor: Matberedningsmaskiner. Ill.        1964 hft 97 s.

76503 Finlands Sjömans-Unions verksamhetsberättelse 1988.  Ill.                   hft 62+62 s.

76506 Eric Bahne:Åtta brev fr. Åboproferssorn Algot Scarin t Erik Benzelius d.y.1942 sft 16 s.

76509 Carl Magnus Schybergson:Västfinskt studentliv på 1870-talet i Helsingfors.1942 sft 14 s.

76518 Wera Helenius: Överrymd och vidd. Efterkrigstidens första missionärsresor.1949 sft 48 s.

76519 publicistförbunds Vårgala:Ids du i mars el. Så tuktas en argbigga.1955 sft 20 s.

76520 Alfhild Forslin: Balladen om riddar Olof och älvorna. Traditionsunders.1962 hft 92 s.

76521 Bengt Pihlström (ed): Look at Finland 1917-77.   Rikl.ill.                     1977 hft 76 s.

76522 The Maritime Museum of Finland.Annual report 1981.Jussarö vrak,”Sofia Maria”. sft 16 s.

76524 Marianne Fredriksson: Den som vandrar om natten …                       1990 poc 412 s.

76527 Helen Reilly: Hur dog Veronica ? Nya månadsdeckaren.                    1963 inb 256 s.Op

76528 Åke Gulin: Silhuett.  Dikter.                                                              1963 hft 65 s.

76529 Börje Löfving:Knubben och Plutten VII:Knubben och djurbarnen. Ill.1956 sft 16 s.

76532 Köksalmanack 1980. Red:Elisabeth Tham.  Rikl.ill.                                        pb 213 s.

76533 Rowena Farre: Fjärran från världen.  Fr. eng. landsbygd.                   1963 hft 208 s.

76535 Ulla Ekh: Inga och Jimmy flyttar.   Ill.                                               1987 hft 64 s.

76536 Ronny Ambjörnsson m-fl.:Fyra resor.Etiopien,Kenya,Tanzania,Zambia.1971 poc 208 s.

76537 Salman  Rushdie: Morens sista suck.                                                 1996 poc 406 s.

76538 Tarjei Vesaas: Blekplatsen.                                                              1966 poc 186 s.

76539 Ronnie målvakten med Ronnie Hellströms o Sven Lindbergs målvaktsskola.1974 hft 104 s.

76540 Sakari Mustakallio: Kräftsjukdomarna.   Ill.                                       1952 hft 83 s.

76542 Bosse Larsson (red): Allsånger 2. För Allsång på Skansen. Fläckig.    1980 sft 72 s.

76543 Alfred Hitchcocks mysteriemagasin nr 2 maj-juni 1964.                              sft 80 s.

76544 Thomas C Hinkle: King. Historien om en fårhund. Ill.                         u å  pb 128 s.

76545 Berlitz ´ Travel guide: Jamaica.  Rikl.ill.                       1981 poc 128 s.

76546 Philip H Coombs:Utbildningens världskris.Utbildn.explosionen i u-land o i-land.1969 hft 239 s.

76547 Sven A Sundberg:Om Fogdö sockens scholaeinrättning o Fogdös äldsta skolhus.1965 sft 6 s.

76548 Naima Jakobson: Befrielse.                                                              1920 hft 147 s.

76550 Thure Wahlroos: Teaterminnen I.                                                      1969 hft 99 s.

76551 Manfred Waffender & Jonathan Walters:Resa på annat sätt: LONDON.1984 poc 257 s.

76553 Vigdis Garbarek: Veien til deg selv.  Dikter.                                      1992 hft 93 s.

76554 Benjamin Hoff: Tao enligt Puh.  Nalle Puh funderar.  Ill.                    1989 poc 189 s.

76557 Finska skogsvårdsfören. Tapio:Tapio nr 9-1909.Timmerflottning,tallkräfta. sft 32 s.

76559 Tidens kalender 1976. Med artiklar o kalendarium över årets händelser.     inb 251 s.

76560 Erik Lunqvist: Dajak.   Fr. Borneo.                                                    1949 pb 240 s.B

76561 Studs Terkel: Rapport från amerikansk stad:Chicago.                         1968 poc 299 s.

76562 Sigge Stark: Rune tar rodret.                                                             1952 klb 143 s.

76563 Cora Sandel: Alberte och Jakob.                                                       1968 poc 240 s.

76564 Dea Trier Mörch: Vinterbarn.  Att föda barn.  Ill.                              1977 poc 296 s.

76565 Patrick Suskind: Duvan.                                                                   1988 pb 80 s.B

76566 Ikbal Athar: Pakistan. Ett u-lands våndor.                                          1972 poc 150 s.

76568 Antoine de Saint-Exupery: Postflyg syd. Övers.:Gunnar Ekelöf.          1978 poc 128 s.

76569 Maj-Britt Eriksson: Sjösvinga kring Nämdö.  Ill: Harald Lindberg.        1976 inb 160 s.B

76570 Folke Fridell: Dag som ovan.                                                             1964 inb 152 s.Op

76571 Barbro Alving: Sol över torpet.                                                          1963 pb 195 s.B

76573 Tore Zetterholm: Vi möts vid Rynge. Fr. 1811.                                  1973 pb 230 s.B

77501 Olof Mustelin: En förläggare och hans författare. Holger Schildt 1913-17. 1983 hft 91 s.

77505 Turistord i Norden. Dansk-finsk-färöisk-isländsk-norsk-svensk turistordlista.1970 hft 95 s.

77506 Program upptagande de förändringar vid Gymnasium i Åbo under läsåren 1860-63. 1863 hft 31 s.

77507 Herman Harris Aall: Faren fra öst.     Lite skadad.                             1925 hft 62 s.

77510 Christoffer H Ericsson: Emigrantklippern ”MILTIADES”-en nautisk .. 1968 sft 15 s.

77516 Rolf Lagerborg: Den hemlighetsfulla ön.                                            u å   sft 32 s.

77517 Svante Dahlström: Israel Hansson och Robert Fithie.    Pärmskada.    1936 sft 11 s.

77519 Finlands Sjömans-Union r.f.:s verksamhetsberättelse 1987.                         hft 56+58 s.

77521 Ingmar Fröman:De senkvartära  strandförskjutningarna som växtgeografisk .. 1944 sft 26 s.

77524 Bengt Pihlström (ed):Look at Finland nr 1-1982. Rikl.ill.                             hft 64 s.

77525 Eli Heckscher: Försvarets ekonomiska förutsättningar.                       1913 sft 23 s.

77526 Al. Ahlström: Min första sjöresa med barkskeppet Orient. Ill.             1958 sft 17 s.

77528 Hector Bejar: Peru 65. Anteckningar från en gerillaerfarenhet.           1970 poc 128 s.

77529 Sigge Stark: Cirkus-dansösen.                                                           1952 klb 156 s.

77530 Tidens kalender 1979.  Rikl.ill.                                                                   inb 252 s.Op

77531 Åke Gulin: Akvarium.   Dikter.                                                         1959 hft 76 s.

77532 Alfred Hithcock´s Mysterie magasin nr 6 – dec. 1964.                                  sft 96 s.

77533 Gunnar Hägglund (red): Sicilien.   Resehandbok.  Rikl.ill.                    1979 poc 96 s.

77536 Bertil Karlén: Värme och vatten i stugan.   Rikl.ill.                             1971 hft 83 s.

77540 Finlands Apotekareförbund: Egenvård.  Ill.                                        1989 poc 112 s.

77541 Sveriges Finlandsföreningars riksförbund: Finland i dag-Folkhushållet.  u å  hft 54 s.

77542 Frithiof Nordström: Våra fjärilar II. Nattflyn.  Rikl.ill.                         1948 hft 60 s.

77544 G Rabe: Om segelbåtar segling och båtnavigering. Rikl.ill.                  1949 hft 141 s.

77545 Nationalmuseum/Stockholm: Konstskatter från Wien.                         1948 hft 167 s.

77547 Anais Nin: Venusbarn.  Erotiska noveller.                                          1987 poc 151 s.

77548 Syllander Brekke: Bland sjöfolk.                                                        1955 hft 63 s.

77549 Berlitz: Ryska på resan. 1200 meningar, 2000 ord.                              1984 poc 192 s.

77550 de Petrarca: Sonetti.  Ill. av Olle Snismarck.   På svenska.                  1955 hft 112 s.

77551 Harry Martinson: Förlorade sonen och andra berättelser.  Ill. Ryggskada.1956 pb 88 s.

77553 Red Tops Bästa.                                                                              1964 poc 160 s.

77554 Marianne Höök: Vän av ordning.                                                      1968 hft 130 s.

77555 Viola: Dagblad.   Ill.: Carl Zetterström.                                              1971 hft 118 s.

77556 Max Weber: Vetenskap och politik.                                                   1977 hft 164 .

77557 W Muschtukow – L Tichonow: Die Museen von Leningrad.  Rikl.ill.   1981 kart 171 s.

77560 P O Ekström: Den blomstertid nu kommer.                                        1962 poc 234 s.

77562 Svante Hansson (urval): Moderna ideologier.  Texturval.  Understreckn.1977 hft 248 s.

77564 Turistföreningen i Finland: Turistliv i Finland 1936.  Bildurval.                       pb 69 s.

77565 Hjalmar Dahl: Uppbrott.                                                                   1932 hft 183 s.

77567 Iris Murdoch: Sandslottet.                                                                 1964 pb 274 s.

77568 Kalmar Nations skriftserie XXV-1948 bl.a. Salixprästen S J Enander,Barre hft 66 s.

77569 Västergötlands museum: I Arns fotspår.  Rikl.ill.                                u å   sft 16 s.

77570 Folkjournalen 3-1982.Samlevnad,kärlek,sex.  STOR.  Rikl.ill.                     sft 60 s.

77575 Cora Sandel: Bara Alberte.                                                               1970 poc 274 s. 

78501 Maj-Britt Theorin: Svensk nedrustningspolitik.                                    1985 sft 29 s.

78503 Per Carlson: Nordiskt samarbete.                                                      1986 sft 18 s.

78507 Förbundet för fysisk fostran:Lekar I: Boll-lekar.  Ill.                           1925 hft 77 s.

78508 Arthur Rindell: Åkerbrukskemi för den lägre lantbruksundervisningen.1920 hft 95 s.

78512 Statsminister Hammarskjölds tal i försvarsfrågan.                              1914 sft 24 s.

78516 Otto Stenij: Lugn efter stormen. Berättelser ur sjömanslivet.  Ill.         1924 hft 81 s.

78518 Sten Söderberg: Svenska sjömansbragder av idag. Ett reportage.        1942 hft 73 s.

78519 W A Douglas: Det finländska frihetskrigets inledning o den svenska hjälpen.1918 sft 14 s.

78520 Bertil Bengtsson: Proppshalarna och andra noveller.                           1977 sft 72 s.

78521 Hjalmar Procopé: Ur Finlands svenska litteratur X. Dikturval.             1924 hft 45 s.

78522 Riksförbundet för bildande konst: Modern finsk konst.  Ill.                  1951 sft 26 s.

78524 Börje Heed: Boken om Nautilus. Färden under Nordpolen Rikl.ill.       1958 hft 85 s.

78525 Statens sjöhistoriska museum Stockholm,Sverige.  Rikl.ill.katalog nr 9.1952 hft 48 s.

78528 Göran Djupsund: Illusioner om planering.Kommunalplan. konsekvenser. Förstr.1981 hft 175 s.

78530 V F Sagulin: Priskurant öfver köksväxt och blomsterfrön … STOR.    1901 hft 34 s.

78531 Nils Edén: 1809 års revolution II:Gustav IV Adolfs avsättning.            1911 hft 40 s.

78532 Teatterikartasto: Teatrarnas plankartor ( i Finland).  Ill. 1959 sft 64 s.

78533 Alfred Nyberg: Chicago-Mississippi dränagekanalen. Rikl.ill. STOR.   1900 hft 20+pl.

78535 Sjöfartsverket: Sjötrafikföreskrifter m.m. Internationella sjövägsregler.1983 sft 95 s.

78537 Birgitta Trotzig: En berättelse från kusten.                                         1986 poc 256 s.

78538 Patrick Quentin: Peter Duluth satsar och vinner.  Sned.                      1962 poc 207 s.

78539 Viola (Marianne Zetterström) Ordalek och småmynt.                         1980 hft 170 s.

78541 Dr Björn Palms Svamp-Katekes.                                                      1916 sft 22 s.

78542 Årets dagar 1980. Med historiska händelser.   Ill.                                          helfr 176 s.

78545 Alexis Kraemer: Bröderna Goncourt.  Ill.                                          1906 hft 60 s.¨

78546 Sigge Stark: När månblekan blommar.                                               1952 inb 142 s.

78547 Människan i centrum.  Handbok i psykologi.   Ill.                                  u å  poc 272 s.

78548 Folkjournalen nr 2 -1982.  Stort läs- och litteraturnummer.   STOR.             sft 58 s.

78549 Ulf Nilsson: Först på månen ….      Ill.                                              1969 poc 118 s.

78551 Anonyma Alkoholister: Tolv traditioner.                       1987 sft 36 s.

78553 Facklan. Tidskrift för kristlig tro och forskning.  Kompl. årgång-12 nr.1907 hft 576 s.

78554 Mångkulturellt centrum: Skriven i Fittja.  Dagböcker. Rikl.ill.               1998 hft 160 s.

78555 Finlandssvensk rapport nr 4: Sverigefinnar och finlandssvenskar.         1983 hft 124 s.

78559 ”Att tända ett ljus istället för att klaga över mörkret”Fr. byar i Jämtland.1986 hft 110 s.

78562 Adam Helms: Världens största klubb:Bok-klubbarna.                         1975 poc 149 s.

78563 Stig O Blomberg: Mord i Roslagen.  Årets deckare.                           1992 hft 139 s.

78564 Karl H Salzmann: Der Kampf um den Nordpolen.  Ill.                        1958 klb 77 s.

78568 Beth Mende Conny: Tro på dig själv. En kvinnas väg steg för steg.     1997 kart 50 s.

78571 Yngve Janson: Genom elden.   Dikter.                                               1940 hft 100 s.

78572 Erik Lundqvist: Ingen tobak inget halleluja.   Fr. Nya Guinea.              1968 inb 252 s.Op

78575 Artur Lundkvist: Himlens vilja. Om Djingis Kahn.                              1971 poc 196 s.

80502 Lennart Björkquist (utg): Fornvårdaren.Heimbygdas tidskrift I(Östersund).1946 hft 48 s.

80508 Ture Seck & Rune Åquist: All världens limerickar. 1968 poc 77 s.

80510 Violinistens favoritmelodier I. 15 omtyckta komp. Dvorak,Strauss,... M noter. Sft 28 s.

80511 Tom Holger: Morfar. Episoder för barn Utg. i Esbo. 1975 hft 54 s.

80512 Mönsterblad för Nordisk hemslöjd. Kartong 4.Prydnadsvävar,kuddar

80516 Gymnasistmötet i Åbo den 15 augusti 1917. sft 31 s.

80517 Förteckning öfver embets- och tjenstemän samt närvarande studerande vid Kejserliga

                                      Alexanders-Universitetet vår-termin år 1852. sft 31s.

80518 Nils Stjernberg: : Försvarsfrågan och den s.k. konstitutionella konflikten.1914 sft 16 s.

80522 Tom Alexander: Apolloprojektet. Amerik. månfärden. Ill. 1966 poc 258 s.

80523 Åke Elmér: Från Fattigsverige till välfärdsstaten. 1969 poc 141 s.

80524 Naantali Music Festival 17.6. – 29.6. 1983. Rikl.ill. hft 88 s.

80525 George Gamow: Universums skapelse. Ill. 1961 poc 128 s.

80526 Herman Neander: Bland krigsfångar i Ryssland,Sibirien och Japan. 1920 pb 135 s.

80527 Lars Adaktusson: Det gudomliga USA. Reportage. Ill. 1983 hft 160 s.

80528 Runar Schildts noveller. I urv. av Henrik Cederlöf. 1969 hft 202 s.

80529 Lars Gustafsson (red): Forskningsfält och metoder inom litteraturvetenskapen.1974 poc 256 s.

80530 Sture Källberg: Agnarna i vinden. 1976 pb 263 s.

80532 Kerstin Wikberg: Samhällets skrattspegel. Studier i Grönköpings veckoblad.1978 poc 187 s.

80534 Gregory Grossma: Ekonomiska system. I öst o väst,historia,.. 1970 poc 200 s.

80535 Anonyma Alkoholister : De tolv stegen. 1952 sft 90 s.

80536 Program SJ:s Jubileumskavalkad 13 juni 1981. Rikl.ill. sft 48 s.

80537 Karta över Stockholm. Ihopvikt i pärm. 1974

80540 Thomas Hammarberg: Massmedia och vår bild av världen. Ill. 1981 hft 268 s.

80541 Carl Hamilton: Krönika. Bankerna,krisen,moralen. 1996 poc 222 s.

80542 John Fletcher: Så tuktas en hustyrann el Äkta mannen och hans överman.1961 poc 136 s.

80545 Jan Myrdal: Den albanska utmaningen 1968 -86. Ill. 1987 poc 194 s.

80547 Kaj Attorps:Det är inte lätt att vara vuxen,förstod jag i somras. 1974 poc 188 s.

80548 Jacques Bergier: Industrispionage. 1971 hft 194 s.

80549 Hilkding Pleijel m.fl.: Våra äldsta foklkböcker. Bibel,almanacka,katekes ..1967 poc 199 s.

80551 Per Holmer: Berättelser i Höjden. 1977 poc 228 s.

80554 Bertil Ahl: Dragningen. Fotbollsroman. 1979 poc 293 s.

80555 Viola: Årsbeättelse. Kåserier. 1979 hft 123 s.

80556 J G Leithäuser: Stränder bortom synranden. Geograf. uppt. historia.1965 poc 388 s.

80557 Jan-Eric Palm: En elektriker gick bort på fest. 1967 hft 144 s.

80558 Sigfrid Svensson: Bygd och yttervärld. Ill. 1969 poc 141 s.

80559 Peter Nilsson: Hem till jorden. 1993 poc 240 s.

80562 Marianne Fredriksson: Evas bok. 1992 poc 212 s.

80565 Lennart Nyblom (Red Top): Sök vid nymåne. Ill. 1980 poc 204 s.

80566 Per E Rundquist: Sven-Patrik. 1952 pb 200 s.

80568 Karl Östman: Stabbläggare och andra noveller. 1976 poc 252 s.

80570 Björn Kurtén: Den svarta tigern. 1984 poc 252 s.

80571 Sten Bergman: Vildar och paradisfåglar. Ill. 1954 inb 250 s.Op

80572 Per-Erik Brolinson & Holger Larsen. Good vibrations. Rockmusikens stilar. 1999 poc 254 s.

81504 Carl-Rudolf Gardberg: Brittiska resenärer i Åbo 1804-27. 1966 sft 32 s.

81506 Åbo Akademi. En översikt. IV uppl. Ill. Lite fuktfläckar. 1947 hft 58 s.

81508 Carl August Gosselman: Besök på Ertholmarne. Faksimil fr. 1842. sft 60 s.

81509 Advantages of the port of Antwerp. Rikl.ill. 1935 hft 80 s.

81510 Helsingfors universitetsbibliotek: Historieforskning i Finland. Utställning 1975. sft 28 s.

81511 Pablo Wiking-Faria: Resan med Joh. Gorthon 1985. Rikl.ill. 1987 sft 39 s.

81512 C A Nordman: Gotland och Uppland i Finlands forntid. Ill. 1935 sft 19 s.

81513 Poul Nyboe Andersen: Nationalekonomi. 1968 pb 237 s.

81516 Wyndham Martyn: Mr. Devlin-Trents överman. Detektivbok. 1931 hft 95 s.

81517 Andrew Bluhm: Fotosats. Sätteriteknik. Rikl.ill. 1969 hft 69 s.

81518 Natur- och kulturmiljöer I: Odlingsbygd i Stockholms län. Rikl.ill. 1993 hft 87 s.

81521 Prinsessan Ingrid – Kronprins Frederik. Minnesalbum. Rikl.ill. 1935 helfr 48 s.

81522 Harry Martinson: Vinden på marken och andra naturstycken. 1964 poc 131 s.

81523 Eyvind Johnson: Se dig inte om ! 1974 poc 199 s.

81527 Finlands konstakademi: Prins Eugen utställning. Ill. 1923 hft 23 s.

81528 Gamlakarleby manskör 1915-55. Jubileumsskrift. Rikl.ill. 1955 hft 72 s.

81530 Lars Widding: Sista sommarlovet. 1972 poc 171 s.

81531 Gunhild Kyle m.fl.: Arbetets döttrar 2. Sociologiska och historiska synpunkter.1986 hft 96 s.

81532 Nils-Erik Finnholm: Tillflykt. Dikter. 1995 hft 55 s.

81533 Helena Friman (red): Blockmakarens hus. Stigbergsgatan 21.(Stockholm). Ill.1982 sft 52 s.

81534 Ricardo Rojo: Min vän Che. 1969 poc 193 s.

81540 Engelska redgeringen upplaga av Englands vita böcker: Innanför taggtråden.1939 sft 47 s.

81541 Osmo Rinta-Tassi: Överblick över Finlands historia. Rik.ill. 1996 sft 30 s.

81542 Sjöhistoriska museet. Vägledning genom sjöfartsavdelningen. Stockholm. 1938 hft 52 s.

81545 August Hahr: Taflor och skulpturer i Uppsala universitetshus. 1906 pb 98 s.

81546 Gunnel Beckman: Ett slag i ansiktet. 1979 poc 151 s.

81547 Josef Stalin: Teori och praktik. Urval: René Coeckelberghs. 1967 poc 374 s.

81548 C L Taylor: Mors bibel. 1921 pb 130 s.

81549 N W Salmelin: Svenska Finlands skytteförbund 1921-71. Ill. 1971 sft 32 s.

81550 Liljevalchs: Isaac Grunewald. Målningar 1904-44. 1944 hft 27 s. text+ 17 s. planscher

81552 Nyckel till forntiden. Fornlämningar i Stockholms län. Rikl.ill. 1984 sft 14 s.

81553 Hemmens forskningsinstitut m.fl.: Späda barn i goda händer. Ill. 1951 sft 60 s.

81554 Cornelius Ryan: Den längsta dagen. Om dagen D. Ill. 1970 poc 199 s.

81555 Sverre Holmsen: Äventyr i Söderhavet. Ill 1951 pb 189 s.

81557 Lekar II: Spring-lekar, kamp-lekar. Ill. 1923 sft 64 s.

81558 Folke Fridell: Greppet hårdnar. 1970 poc 174 s.

81559 Lasse Strömstedt: I fängelse. Mitt liv del 2. 1984 poc 238 s.

81562 Helsingfors segelsällskap. Årsbok 1988. Ill. hft 101 s.

81563 Amos Andersson 1958: Sigrid Schauman- Målningar. 1958 sft 32 s.

81564 Volodja o Eugen Semitjov (red): Viktor Somovs dagbok. Illustr. 1985 poc 328 s.

81565 Arki Medes: Det geometriska stjärnsystemet innefattande vinkelns tredelning ...1950 hft 31 s.

81566 Barbara von Schoultz: Myrlejon. Dikter. 1963 sft 30 s.

81567 Wilhelm Ljungström: Bara en uppasserska. 1918 hft 128 s.

81568 Lasse Holmqvist (red): Saltat & pepprat IV. Våra bästa kåsörer. 1974 klb 214 s.

81569 Gunnel Högholm: I minnet lyser vägen ljus. Fr. Edesvö. Ill. 1976 hft 91 s.

81570 Jochum Stattin: Näcken. Spelman eller gränsvakt ? Ill. 1984 hft 140 s.

81572 Mazo de la Roche: Vårt eget Jalna. 1970 helfr 264 s.

81573 Pär Lagerkvist: Barabbas. 1975 poc 129 s.

81574 Nicolas Fokker: Där växer inga rosor i sågspånet. 1974 inb 344 s.Op

81575 Algot Sandberg: Med fjäder i hatten. 1916 hft 80 s.

82501 Illustrated guide to madame Tussaud´s. 1979 sft 40 s.

82502 Nej till nyvänstern. Marginalanteckningar av Henrik Cederlöf. 1969 sft 58 s.

82504 Helena Gregorz-Lööv m.fl.: Beskrivningar och berättelser. Etnolog. 1988 sft 70 s.

82505 Toivo Lyy: Nådendal- Naantali.  Bildalbum i färg. u å   hft 40 s.

82506 A E Mander: Att tänka klart. Logik för alla. 1948 hft 130 s.

82507 Wald. Edvardsson: Säg ja till livet.Vad man bör veta om sexlivet. 1949 hft 91 s.

82508 Bertil Palm: Borgholms slott. Kort historik o vägledning. 1970 sft 32 s.

82509 Stefan Dominique: PLO. Fredsrörelse eller terrororganisation. 1989 hft 116 s.

82510 Plankarta över Åbo stad.  Lite revad. u å  utv.karta

82512 Helge Tyrén: På väg mot atomåldern.  Ill. 1945 hft 118 s.

82513 Vår syn. Aktuella debattinlägg av Nyliberala studentförbundet. 1947 hft 74 s.

82514 Sören Jansson: Den moderne bonden.  Rikl.ill. 1987 hft 116 s.B

82515 Antik och auktion: Klubbat på auktion. Årsbok 1986.  Rikl.ill.         hft 192 s.

82516 Heinz Kurth: Trycka böcker.  Rikl.ill. 1975 kart 32 s.B

82517 Leif Gren: Fossil åkermark. Fornlämningar i Sverige 1.   Rikl.ill. 1991 sft 68 s.B

82518 Sigyn Alenius: Finland efter vapenstilleståndet 1944. 1947 hft 55 s.

82520 Fotboll 68. Alla landslagets och Allsvenskans spelare.  STOR.  Ill.         sft 66 s.

82522 Folkjournalen nr 3- 1982. Samlevnad, kärlek, sex.  STOR.  Ill.                  sft 60 s.

82524 Herman Bondi m.fl.: Molekylens byggnad.  Rikl.ill. 1971 kart 64 s.B

82525 Gustaf Olsson (utg): Det nya Sverige. Nation. spörsmål. Bl.a. P J Klinthe. 1927 hft 68 s.

82526 Finlands riksdag. Beskrivning av riksdagen o huset.  Ill. 1952 sft 32 s.

82527 Inger Brattström: Ravindras väg från byn.  Fr. Indien.   1972 kart 136 s.B

82529 Tomas Gerholm: Prolog till en marxistisk antropologi. 1971 poc 192 s.

82532 Ragnar Mannil: Delegationen för den svenska litteraturens främjande 1923-92. sft 29 s.

82533 Jägarens årsbok 1991. Rikl.ill.                                             hft 100 s.

82534 Robert L Heilbroner: Människans framtid. 1975 poc 121 s.

82536 Caleb J Anderson: I denna revolutionära epok … Utrikespolit. essäer.1970 poc 175 s.

82537 Evelyn Waugh: Hissa fler flaggor.  Veckan före II vrk. 1969 poc 192 s.

82541 Anthony Hyde: Red fox. Thriller på svenska. 1986 poc 405 s.

82542 Francis Bull: Världslitteraturens historia. 1969 poc 325 s.

82543 Yngve Berg: Vår historia I: Forntiden och medeltiden.  Ill. 1955 pb 168 s.

82545 Böcker från Finland. Specialnr av ”Books from Finland” på svenska.1996 hft 152 s.

82547 Unga fotografer 1965.  Rikl.ill.         hft 40 s.

82548 Beckers: Konst hobby dekor.   Rikl.ill. katalog. 1969 hft 151 s.

82550 Gun Nihlén: Randi.  Om en bronsålderspjke. 1943 hft 152 s.

82551 Sigge Stark: Försök förstå. 1952 kart 151 s.

82554 Tage Danielssons bok.              1965 poc 120 s.

82557 Perarvid Skoog: Ekologi. Samspelet i naturen. 1971 sft 48 s.

82561 Hemåt. Evangelisk kalender för 1916.  Ill.        pb 168 s.

82562 L Ron Hubbard: Scientologi. Tankens grunder. 1999 poc 183 s.

82565 Marie Neurath & Evelyn Worboys: Så levde man i det gamla Afrika.1971 pb 32 s.

82566 P G Wodehouse: Farbror Fred på vårhumör. 1989 poc 243 s.

82571 Karl Axel Arvidsson: Millesgården i bilder. u å   hft 30 s.

82574 Lauri Hirvensalo: Suomi- saksa- suomi ordbok i fickformat.   1968 hft 254+297 s.

84502 Yngve Löwegren: Våra ryggradsdjur.Hur man preparerar dem. Ill. 1950 hft 95 s. 

84503 Skäggets bästa fräckisar. Uppslagsbok av Åke Söderqvist. 1965 hft 128 s.

84508 Daniel Orädd: Sjöfolkets bästa bedrift.   Ill. 1951 hft 64 s.

84509 Helsinki Harbour bord: Port of Helsinki.  Rikl.ill. 1963 hft 66 s.+kartor

84510 London wharves and docks. 1954 hft 92 s.+kartor

84511 Göran Printz Påhlson (urv): Modern amerikansk berättarkonst. 1965 poc 232 s.

84512 John F Summerill: Tanker manual.   Rikl.ill. 1947 klb 150 s.

84514 Åke Wedin (red): Arbetarrörelsens årsbok 1970.   Ill.        poc 183 s.

84516 Per Olof Ekström: Den vänliga staden. 1969 poc 296 s.

84518 Sigge Stark: Kärlekens lön. Hon där hemma. 1985 poc 141 s.

84521 Johan Nielsen: "Passaden". En skeppshunds upplevelser. 1924 hft 50 s.

84522 Ashwin Belur & Blair Whitaker: Rubik´s magic. Das Lösungsbuch. Ill.1986 poc 94 s.

84523 Amos Anderssons konstmuseum: Hugo Simberg 1875-1917.  Ill. 1968 sft 28 s.

84524 Wolfgang Paul: Mauer der Schande.  Berlinmuren.  Ill. 1961 poc 70 s.

84526 Granskaren nr 3- 1937. Bl.a. W E Nordström, P J Klinthe,E N Tigerstedt   sft 16 s.

84530 Paul Johan Klinthe:En statsrättslig synpunkt på resningsinstitutet i svensk o finländsk rätt. 17 s.

84532 Lea Lampén: Suomi - Ruotsi - Suomi   ordbok. 1970 hft 374 s.

84533 Georg Holmsten: Lucrezia Borgia.  På svenska. 1960 pb 253 s. 

84535 Mumin och delfinen efter den japanska TV-serien. En Mumin pixi. Ill.1993 sft 26 s.

84539 Rune Sternberg (red): Sportfiske 86.   Rikl.ill. 1985 hft 126 s.

84541 All Rome. 100 fotocolor.  "Dragspels"album i färg.                          u å   hft 50 s.

84542 Hundare och skeppslag. Årsskrift för Roslagens hemb.föreningar. 1939 hft 92 s.

84543 Idun- veckojournalen 1963. Rikl.ill. årsskrift.        pb 127 s.

84544 Lars Åke Kvarning & Bengt Ohrelius: Regalskeppet Wasa. STOR. 1974 sft 37 s.

84545 Grafiska institutet avgångsklass ´96. STOR elevkatalog m foton.               sft 32 s.

84546 Helsingfors stads kommunalberättelse 1985. Rikl.ill.         hft 135 s.

84548 Erkki Heino: Sjökaptenens radiobok.  Ill. 1947 hft 140 s.

84550 Gunnar E Sandgren (red): Jägaren 1993-94.  Rikl.ill.        hft 142 s.

84551 Drottning Astrid. Minnesalbum. 1935 helfr 40 s.

84556 Samfundet för Nordiska museets främjande 1884. Bl.a. medlemsförteckn. hft 102 s.

84557 Eileen Alridge: Porslin. Vägledning och råd för samlare. Rikl.ill. 1970 poc 160 s.

84558 Gallerie Hörhammer: Verner Thomé 1878-1953.   Ill. 1955 hft 28 s.

84559 Göran Selén: Borgå medborgarinstitut 40 år.  Rikl.ill. 1986 hft 48 s.

84560 Oslo info 1980-81.  Ill. 1980 hft 298 s.+karta

84562 Börje Lindell: Nils Ferlin. En introduktion.  Ill.             u å   sft 8 s.

84563 Katja Tuominen & Teemu Lehtinen: En kronologi över europeiska integrationen.1997 sft 43 s.

84564 Östergården. Ett hem för åldringar i Sundbyberg. "Lisa Johansson-Pape"1951 hft 40 s.

84565 Sven Gréen: Min trädgård 1982.   Rikl.ill.         kart 104 s.

84566 Gustav Kolthoff & Onni Wetterhof m.fl.: Storjägare i forna dar. 1973 poc 110 s.

84567 Årets rysare 2.   15 chocknoveller. 1973 poc 142 s.

84568 K R Brotherus: Den vetenskapliga odlingen.  Ill.  u å  hft 32 s.

84569 Henry Herlin: Skyddskårsofficersinstitutionens i Finland historia. 1991 sft 16 s..

84570 Nordisk handlingsplan mot förorening av havet. 1990 hft 112 s.

84571 Ingalill Roos: Energitjuvar. I familjen, i relationen och på jobbet. 2006 poc 206 s.

84572 Klaus Törnudd: Svenska språkets ställning i Finland. 1960 hft 80 s.

84574 Halfdan Nylander: Frasfritt. 461 tankekorn. 1981 inb 125 s.Op

84575 Sture Källberg: Den röda älven.  Fr. 50-talets Göteborg. 1979 poc 263 s.


ALANDICA - åländska REA-böcker.

    Matts Dreijer:

36581 Matts Dreijer : Den historiska bakgrunden till Ålands självstyrelse.  Ill. 1971 sft 72 s.  1,-

36584 Matts Dreijer: Nordens kristnande i ny belysning.  Ill.     1987 sft 16 s.                        1,-

37584 Matts Dreijer: Glimtar ur Ålands historia.  Rikl.ill.       1967 sft 46 s.                            1,-

44576 Matts Dreijer : Med bil genom Ålands historia.   Rikl.ill.  1964 sft 25 s.                        1,-

44577 Matts Dreijer :Manlig åländsk folkkonst.Trä-,ben-,metall- o sjömansarbet.1938 hft 48 s. 1,-



36582 Ål skrivare 4.Ant.,bla K-E Bergman,R Salminen,J Scott,D Ingman,T Johans 1983 hft 96 s.

36583 Lorentz Bryggman : Femtio folkvisor från Åland. III saml. Med noter. 1985 hft 62 s.

36585 Åländsk Odling 1984. Bla : Sältingskär fiskeläge,Borgboda,Kastelholms slott    hft 224 s.

37581 Ål. Odl.1984 bla : Väinös haveri 1894,storskifteskartor           hft 224 s.

37585 Åländska skrivare och konstnärer.     Med biografier o färgill.  1976 hft 147 s.

38584 Thorvald ”Thusse” Eriksson : Åländsk frihetskamp. Återblick på 60-talet. 1992 sft 39 s.

38585 Ål.Odl.1984 bla: romarguld på Ål.,spännbuckla fr. Eckerö,storskifteskartor. hft 224 s.Ill.

40581 Ål Odl. 1984.Bla Kastelholms slott,Sältingskär fiskeläge,C-J Calonius-tullare hft 224 s. ill.

40582 Åländska skrivare 3.         Med korta biografier.    1978 hft 103 s.

40583 Karl Kåhre: Ålands sjöfartsmuseum - kort historik.   1982 sft 47 s.

42582 Åländsk Odling 1984.Bla Romartida guld på Åland,Sältingskär fiskeläge          hft 224 s.

42581 Ethel Karlsson : Jord och drömmar.   Blandade dikter.       1969 sft 51 s.

42584 Gunvor Javen : Ristning mot rymder.  Dikter,ill. av förf.   1993 hft 91 s.

44581 Åländsk odling 1984 bla : Sältingskär fiskeläge,Skonerten Wäinös haveri  1894  hft 224 s.

44582 Ålands konstförening 1953-78.  Ill. historik o matrikel.     1978 hft 114 s.

44584 Stig Jaatinen & Nils Meinander m.fl.: Ålänningarna och deras näringsliv. Ill.1969 inb 131 s.Op

44585 Fredrik Lundberg: Åländska studentgillet r.f. 1905-95.Ill. historik.  1996 sft 46 s.

45583 Pia Maria Flodin : Om konsten att simma. Noveller.    1990 hft 97 s.

45586 Ålands sommaruni : Det nya östblocket. Red.: Olle Anckar.  1991 hft 115 s.

45588 Gustav Oberg : Vid livskällan.  Sånger och dikter.    1954 hft 96 s. 

46576 T Modeen:The intern. protection of the national identity of the Åland Islands.1973 hft 35 s.

46578 Ethel Karlsson : Under Orion.  Blandade dikter.   1971 sft 66 s.

46579 Ålands ömsesidiga försäkringsbolag 1866-1966. Festskrift.  Ill. 1966 hft 83 s.

46580 Sigrid Backman : Ålandsjungfrun.     1961 klb 191 s.

46582 Göran Stenlid : Åländsk botanik – en bibliografi.   1999 sft 103 s.

48584 Tidskr. Radar nr 2/2000: IT,teknik och framtid.Danne Sundman,A Ingves,M Hanström m.fl. hft 98 s.

48587 Thorvald ”Thusse” Eriksson : Överkörd självstyrelse. Debattskrift.  Ill.  2006 sft 48 s.

49581 Åländska skrivare. Utg.: Ål. litteraturförening. Den första antologin.  Ill.  1974 hft 114 s.

49582 Nordens institut på Åland 15 år : Möte med milleniet. Inl.:May Flodin.  Ill  2000 hft 55 s.

49584 Rainer Alander : Små stycken av Stockholm.       Ill.     1996 hft 111 s.

49585 Casper Wrede : Politiskt deltagande på Åland. Orsaker till lågt valdeltagande. 1981 hft 154 s.

49587 Thorvald Eriksson : Så tillkom Ålands självstyrelse och så försvaras den.  Rikl.ill. 1976 hft 48 s.

49588 Eivor Lindström : Drömmarnas äng.       Dikter.         Pärm lite skadad.  2000 hft 54 s.

49589 Tidskriften  radar nr 3-1998 : Tema : frihet. Det åländska dilemmat.  Ill.          sft 49 s.

49590 Svenskbygden nr 3-2007. Tema: Med kurs på Åland.  Ill.       sft 44 s.

50577 Erik Tudeer : Ålandsbanken 1919-1989.  Rikl.ill.  STOR. 1989 helfr 71 s.

50578 Ålands landskapskalender 1974.  Enstaka anteckningar.         hft 270 s.

50580 “ folket kan företa sig att vakna” Ål. socialdemokrater 75 år. Ill. 1986 sft 31 s.

50581 Landskapsstyrelsens berättelse till Ål. landsting  1975.  1976 hft 215 s.

50585 Arvid Jansson : Min levnadsteckning och berättelse.  1971 sft 34 s.

52576 Landskapsstyrelsens berättelse 1986.Förvaltning och ekonomi.         hft 325 s.

52577 Ralf Nordgren : En rörelse i landskapet.  Dikter.  1998 hft 59 s.

52578 Åländska studentgillet : Slaget om Bomarsund. Ill.  1967 sft 24 s.

52581 Tidskriften radar nr 4-1999. Tema : Åländsk journalistik.       Ill.                hft 112 s.

52583 Lemlands ungdomsförening 1902-72.  Ill.          sft 29 s.

52585 XIV sång- och musikfesten i Mariehamn 1966.  Ill.  1966 hft 136 s.

53576 Ålands landskapskalender 1983.   Oanvänd.                                      hft 200 s.+kartor

53577 Lennart Segerstråle ”Världsförsoningen”.Glasmåln. i Finstr. kyrka.                  u å  sft 16 s.  Ill.

53579 Lantrådet i landskapet Åland: Berättelse avgiven till Ålands landsting 1969. hft 144 s.

53581 J A Perera : Trons segrar.  Livshistoria.                                                1973 sft 40 s.

53585 Teaterfören. i Mariehamn: Djävulen och Törnrosa.Teaterdräkter fr. 85 år.        1999 sft 39 s.

54576 Valdemar Nyman: Du lilja i gröna dal … Om Kyrkdalen. Ill. 1954 sft 25 s.

54579 Horisont nr 7-1973.  Temanummer om Åland.                                  hft 96 s.

54580 Ålands konstmuseum 1974: Joel Pettersson.   Text: V Nyman.                     sft 16 s.

56576 PQR.  Nr 1 – 1980.Kultur-samhälle-miljö.  Ill.           sft 60 s.

56578 Ålands Museum: Graffitti.     Rikl.ill.   1995 sft 28 s.

56579 Ålandsforskarna: Spirkasen nr 14.Bla Skag i Lumparland,Pollin i Sund.1995 sft 16 s.

56580 radar – Nr 1-1998 Skärgård.Bla Henrik Beckman,Marie Hanström,John Wrede  hft 88 s.

56581 K N Dahlblom: Ålands Lyceum 1958-59.  1959 sft 47 s.

56582 Musikteatern Katrina. Program 1998.        Rikl.ill.          sft 26 s.

56584 Ålands landskapskalender 1982.  Oanvänd.          hft 208 s.

57576 Jan Sundberg: Ålands skeppsbefälhavareförening 1893-1968. Ill. 1968 sft 40 s.

57577 Carl-Adam Haeggström & Marja Koistinen: Ålands fridlysta växter. 1999 sft 76 s.

57578 Arvid Jansson: Visor , del 2.   Med noter.   u å   sft 18 s.

57579 Benita Mattsson-Eklund: Mariehamns sångkör 1938-88. Rikl.ill. 1988 sft 35 s.

57580 Rainer Kronstam: Finströms sångkör 100 år 1896-1996.  Ill. 1996 sft 19 s.

57583 Historielärarnas förening: Åland-ett självstyrt landskap.Ill. artiklar.  1993 sft 52 s.

58576 Svea Manselin: Folkskolan i Lemland 100 år.  Ill.                          1986 sft 32 s.

58577 Valdemar Nyman: Litet änglaoratorium i Finströms St. Mikael        1864 sft 14 s.

58579 Thorvald ”Thusse” Eriksson: Åland i motvind.Finl. moraliska Ål.kris.1996 hft 181 s.

58584 Åland ´74: Välkommen till Åland.   Rikl.ill. turistbroschyr.                 hft 74 s.

58585 Gyrid Högman: Ålands lyceum läsåret 1994-95.  Ill.                   1995 sft 38 s.

60577 Joel.  Programhäfte till Joel Pettersson-operan.  Rikl.ill.             2009 sft 36 s.

60578 Kjell Ekström: Graffitti.   Riklill.                                                 1995 sft 20 s.

60582 radar nr 3-2001. Tema:Samhälle.  Ill.                                                  hft 71 s.

60583 Åländska skrivare: Dikt från skilda tider – en antologi.               1992 hft 134 s.

60584 Jorden runt nr 4 –1977. Åland-Bornholm-Korea-Mexico.  Ill.             sft 70 s.

60585 Nordiskt skärgårdssamarbete: Drömmar i månvaggan. Skärg. kultur.  1993 hft 60 s.

61577 Gurli Perera & Gudrun Forss:Innanför paradisets portar.Märklig upplevelse.1984 sft 77 s.

61578 Jorden runt nr 3-1976. Ålandsnummer.  Rikl.ill.                                        sft 90 s.

61579 Bjarne Lindström: Nationalstaten,regionerna och det framtida Europa.1992 sft 45 s.

61580 Kulturtidskriften PQR nr 2 -1983.Tema:skärgård. Bla Kökar o Föglö.         sft 64 s.

62577 K N Dahlblom: Ålands lyceum 1959-60. Årsberättelse.                      1960 sft 44 s.

62578 Martin Isaksson & L I Johansson: Åland –självstyrt demilitariserat område.1984 sft 39 s.

62579 Leila E Järvenpää-Lithen: Kronohäktet Vita björn 1784-1975. Ill.           1986 sft 20 s.

62581 Ålands landskapskalender 1976.   Oanvänd.                                       hft 174 s.+karta

62582 Miniatyrstaden Mariehamn på 20-talet. Vitrin 1 och 2.  Rikl.ill.               1997 sft 36 s.

62583 Cutty Sark Tall Ship´s Race 1988.  STOR programtidning.                            sft 60 s.

62584 En 40-årig kulturgärning på Åland. Fören. Ålands Vänners verksamhet.1936 sft 27 s.

64576 Solveig Bäckman: Ålands mentalvårdsförbund 50 år 1934-84.  Ill.       1984 sft 40 s.

64577 Teija Tiilikainen: Åland i Europas säkerhetspolitiska omvälvning. Ill.      1999 sft 48 s.

64580 Åländska studentgillet: Slaget om Bomarsund.  Ill.                               1967 sft 24 s.

64582 Kaj Lindholm-Bertil Roslin: Huvudstad i ett självstyrt örike ? Ill.            1982 sft 46 s.

64583 Ålands landskapskalender 1972.  Med lite anteckningar.           hft 254 s.

64585 Landskapsstyrelsens berättelse 1982. Förvaltning och ekonomi.                   hft 314 s.

65576 Vald. Nyman:Personhistoriska förbindelser mellan områdena för de gamla Linköpings

    och Åbo stiften.  Bla om Henrik Johan Gummerus.  Ill.                         1947 sft 10 s.

65577 100 år med ÅLAND. Tidningens jubileumsutg. STOR. Rikl.ill.           1991 sft 56 s.

65578 Ålands konstmuseum: Fyra + fyra.   Bla Johan Scott o Olof Kangas.  1988 sft 36 s.

65579 Spirkasen nr 10. Bla ”Rosenbergs-Kalles” minnen.  Ill. 1993 sft 32 s.

65581 Kjell Ekström: Eckerös midsommarstänger.  Ill.                                 1990 sft 15 s.

65582 Nils G Holm: Finlandssvensk skolungdom om religion och samlevnad.1979 hft 123 s.

65583 PQR nr 1 – 1993.  Bla Hans Jonstoj o Greta Sundström.  STOR.               sft 12 s.

65584 K N Dahlblom: Ålands lyceum läsåret 1958-59. Årsberättelse.                 sft 47 s.

66579 Ålands litteraturförening: Noveller & livstycken.  Antologi.                 1996 hft 126 s.

66581 Källan nr 1-2011. Tema:musik. Bla Svea Jansson- vissångare.                     hft 62 s.

66583 Husö biologiska station nr 19:bla knölsvanen i ål. sjöar,insjöundersökn. 1977 sft 111 s.

66584 Sverre Scott: Bomarsunds fästning.  Kort historik. Ill.                         1974 sft 16 s.

68576 Skötbåt. En serie bilder av Henrik Nylund.  I färg.                             1980 sft 16 s.

68577 Ålandsforskarna: Spirkasen nr 6.  Gårdsporträtt, gamla foton.             1990 sft 10 s.

68578 V. G-l ´s Tokroliga och andra dikter.  (=Viktor Gensel).                      1969 sft 33 s.

68579 Mariehamnskvartetten 1936-96.  Sånghäfte o program                       1996 sft 12 s.

68580 Ålands redarförening r.f.: Årsberättelse för 32:a verksamhetsåret 1965. Ill.sft 25 s.

68581 PQR nr 2 – 1984.Bl.a. Helle Hellberg 100 år,sommar-Åland,skärgården    sft 58 s.

68582 Åländska studentgillet: Hälsning till hembygden – vintern 1958. LAKANSTOR.     6 s.

68583 Lions Club Mariehamn 25 år.  Ill.                                                      1981 sft 21 s.

68585 Ålands landskapskalender 1986.                                                                hft 150 s.

69577 Ålands redarförening:Årsberättelse för 20:e verksamhetsåret 1953. Ill.       sft 17 s.

69578 Rederi AB Sally: m/t Bonny.  Presentationsbroschyr.                         1969 vikt 6 s.

69579 Sally Info nr 2-87 : Rederiaktiebolaget Sally 1937-87. Rikl.ill.              1987 sft 12 s.

69580 Ålands sjöfart & Handel nr 2-1986. Bl.a. Algot in memoriam                      sft 48 s.

69581 Kvarnbo Lions historik 1968-93.  Rikl.ill.                                            1993 sft 28 s.

69582 Folke Wickström: Mariehamns stadshus 50 år. Fullm. behandl. 1934-39. 1989 sft 16 s.

69585 Hälsning till hembygden vintern 1957.Bl.a. Doris Eklund,Carl Ramsdahl         6 s.

70576 Museinytt från Åland Nr 1-1980. Ålands jakt- o fiskemuseum. STOR.        sft 12 s.

70577 Ålandsforskarna:Spirkasen nr 11.Bl.a. Johan Mattsson,Mångstekta:Memoarer sft 16 s.

70578 Ålands museum: Alla dockor ropar på mamma.  Dockutställning.        2002 sft 32 s.

70579 Danny Lindqvist: Gör affärer med Åland.   Rikl.ill. STOR.                  1993 sft 28 s.

70580 PQR nr 1 – 1983. Tema : Norden. Ill.                                                        sft 64 s.

70581 Ålands kulturdagar: Program 25-29/3 1953. Ill.                                            sft 31 s.

70582 Turun Sanomat torst. 11/6 – 1987.Helsida:Kevätlinnustus verotti yli 50.000

                     räpyttelijää.    Om vårfågeljakten på Åland.  Med bilder.        STOR.

70585 Historiska museet-Tidn. Åland: Historiska nyheter nr 18. Ålandsnummer. 1981 sft 24 s. 

72576 PQR – nr 1 – 1994.Bl.a. Broge Wilen,Håkan Kulves,Bo Lönnqvist. STOR. sft 52 s.

72577 PQR – nr 4 – 1983. Bl.a. Valdemar Nyman,Lars Huldén,Bo Carpelan.         sft 63 s.

72579 Otto Andersson: Upprepningsstrofen. En folkloristisk formstudie.        1950 hft 55 s.

72580 Martin Isaksson: Bomarsund-guide.  Utg. Ål. turistförening. STOR.    1979 sft 11 s.

72582 Bjarne Henriksson:På havets villkor. Dokumentsamling.                     1995 sft 15 s.

72584 Carl Ramsdahl: Ålands fiskarförening 1927-52.  Ill.                            1952 sft 29 s.

72585 Ålands landskapskalender 1970.                                                    1969 hft 221 s.

73576 Ålandsforskarna: Spirkasen nr 6:II bl.a. ål. folkdräkter,Granboda flygstation  sft 24 s.

73577    -  ”  -               : Spirkasen nr 31bl.a. bröllop på Åland,fartygsolycka 1832   sft 22 s.

73582 PQR nr 2-1982 bl.a.:Åländsk förljugenhet,Tage Wilén,Doris Ingman          sft 56 s.

73583 Ålands landskapskalender 1981.                                                              hft 210 s.

73584 Erik Sundberg: Eckerö frivilliga brandkår 50 år. Historik 1935-85.             sft 26 s.

73585 Minnesutställning Robert Hancock 1912-93.  Rikl.ill.                          1998 sft 20 s.

73586 Cinderellas à la carte.  Receptsamling fr. fartyget. Ill.                        1994 hft 56 s.

74578 Fotoklubben Obscura: Åland fotokalender 1984. STOR. Färgbilder.

74579 Hälsning till hembygden julen 1960. Bl.a. Vald. Nyman,Joh. Salminen  STOR. 6 s.

74581 PQR nr 2-1980. bl.a. Helli Forsberg,Sixten Jansson,Richard Palmer.           sft 46 s.

74582 PQR nr 2-1985: bl.a.Robert Hancock,begravning på Kökar,havet.               sft 56 s.

74583 Ål. spelmansgille: Åländsk folkmusik för två fioler. STORA häften nr 1-10.   1 e / hft

74584 Ålands landskapsarkiv: 1939- ett ödesmättat år för Åland. STOR.       1989 sft 32 s.

74585 Ålandsforskarna: Spirkasen nr 33.Bl.a. F D Scheffer,tidiga vikingar,Själö hospital sft 20 s.

76576 Folke Wickström:Mariehamns stadshus 50 år.  .. behandling åren 1934-39.1989 sft 30 s.

76580 Skärgårdsprojektet: Stughandbok.                                                            1984 sft 43 s.

76581 Ola Nyqvist: Utvecklingsarbete i små kommuner.                                    1989 sft 46 s.

76585 Ålands självstyrelse 1922-97.Festkosert.V Nyman:Ludus Latrunculorum. 1997 sft 10 s.

77577 Gurli Söderlund-Perera: Min axplocksbok.                                         1976 sft 34 s.

77581 Stig Nordman:Manskören Åländska sångare 1954-74. Några stänk     1974 sft 43 s.

77582 Gunnar Gottberg: Om gäddans tillväxt i Ålands skärgård.                    1917 hft 21 s.

77583 Thorvald Eriksson:Om förutsättningarna för ekonomisk tillväxt på Åland.1970 sft 50 s.

77584 Åland självstyrelse 75 år: Åland ett självporträtt. Fotodokumentation.  1997 sft 28 s.

78577 Rederiaktiebolaget Linden. Emissionsprospekt -92.  STOR.                         sft 16 s.

78580 Ålands redarförening: Årsberättelse för 37:e verksamhetsåret 1970.             sft 20 s.

78582 Uthyrningsstugor i samband med gårdsbruksturism och skärgårdsföretag.1983 sft 44 s.

78584 Ålands fåravelsförening: Ängamat. 30 recept på lammkött.                 1996 sft 16 s.

80577 Mariehamns juniorhandelskammare r.f. 1964-94. Ill. 1994 sft 35 s.

80578 Ulla o Tage Boman: Ålands försöksfält – Ålands försöksstation 1938-88. 1988 hft 61 s.

80579 Ålandstidningens jubileumsupplaga april 2001 – 110 år. Rikl.ill. 2001 sft 75 s.

80582 Göran Jansson: Den tatuerde ålänningen. Rikl.ill. 1994 sft 48 s.

81577 Lars Grönstrand: Sigyn. Rikl.ill. 1980 sft 16 s.

81578 Ålands landskapsarkiv: Karl Neårk,Signe Haluja o andra ovanliga namn .. u å sft 18 s.

81579 Rainer Kronstam: Finströms sångkör 1896-1996 100 år. Ill. 1996 sft 19 s.

81580 Bertil Roslin: Åland i ett regionalekonomiskt perspektiv. 1972 sft 24 s.

81584 Ålands landskapsarkiv: 1921- avgörandets år. Ålandsuppgörelsen. STOR. 1991 sft 18 s.

81585 Ålands författningssamling n:o 5-7 1952: Självstyrelselag för Åland. 1952 sft 20 s.

82577 Goboin nr 1 – 1981.   Ill.         sft 26 s.

82578 Landskapsarkivet: 1939 – ett ödesmättat år för Åland.                  1989 sft 32 s.

82580 Claes-Göran Wetterholm: Ångaren Per Brahes märkliga öden. Ill.     u å   sft 18 s.

82582 Per-Ove Högnäs: Renovera fönster. Råd o historik.  Ill. 1998 sft 26 s.

82583 Idrottsföreningen Kamraterna r.f. Mariehamn. Årsberättelse 1988.            sft 60 s.

82584 Ålands landskapsstyrelse-trafikavdelningen: Våra färjor 94.  Ill.          sft 18 s.

578 Ålands Bygg ab redovisar Projekt -77. S-gården,museet,Arkipelag. 1983 sft 31 s.

84581 Idrottsföreningen kamraterna r.f. Mariehamn: Årsberättelse 1992.             sft 80 s.

84583 Ål. lands.styrelse:Europaintegrationens konsekvenser för Åland-en inventering.1989 sft 63 s.

84584 Ål. landskapsarkiv: 1922- året då självstyret började. Ill. STOR. 1997 sft 21 s.

84587 PQR nr 2/3 - 1993. Bl.a. Leo Löthman, Olof M Jansson, Jonas Wilén.       sft 48 s.