BIOLOGICAL DATABASE

your ped agent/emoji/image goes here (Representative image: optional)

Welcome message to set the context

Assume you are a scientist, and you have identified novel protein in a E. Coli organism. You must identify the other related protein.

(Representative image: optional)

Let's understand the task!

[Explain the task and how it will proceed towards completion. Describe the different phases and the expected deliverables/outcomes for each phase.]

You could modify/add on to this image to convey your task and outcomes in the best possible way

Representative image (optional)

Build a story here to engage your learners.

•E. Coli is pathogenic strain

•Involve on capsular biosynthesis

•The following is the amino acid seq of protein

LPSCSRMTEKKTNMASINSVEWRSICDKFTNAQRLTETESRNDPENEPFRSKYKARELLREIYCSLKSFEAGDGEEDAGGENCEQRPPDQPVDGQTEDAFSQGLSGDSPAGMRAAKLGAVEYYLGVNHVDTEELSAGQEHLMNCMKMLEKCRASSENVSLFIHVRNQLGILWAGRDETEAAQGFLESAESIYQRYMKEDGRPPTDMTEYFTTEENLLTHQERTKRFELAYTHTMYYLAQVYKNLGENERAATYCHSTLQRQLQLNQFSPMEWALNAATLSQYYITKGRYMEGRHCLAAATVISGLAGEVPSEAAAQESETERERREQLQQKRAEIARCWIKYCLNLLQDA KKLLEDNIGELDTDRQDELKRARRQEVTLRMFSV

[What goes here?: Focus on eliciting learners' prior knowledge. Probe them to form a hypothesis (to be tested further), make an assumption to start approaching the problem

Create a Google form. This Google form will act as a notepad for the learners and a data collection/assessment tool for you to assess learners' understanding. Frame questions that are relevant and useful for the problem context set. Try to be elaborate in conveying the question. Avoid confusing/verbose sentences, jargon, and ambiguity. Try to keep the instructions clear. Remember, if you want to use it for assessment, your questions should be able to give you a clear and measurable answer. ]

Your interactive video goes here.

[Choose a video that is in narrative form (like a story/documentary).

Keep the video short (Not more than 5-7 minutes, less is more :))

This will help establish a personal connect with the content and make it relevant for the learners.

Insert reflection spots (questions) in between to keep the learners engaged with the content. ]

[What goes here? : Focus on learners' observation skills here. Probe them further about their observations. Ask them to think about these observations with respect to the problem context at hand.

Create a Google form. This Google form will act as a notepad for the learners and a data collection/assessment tool for you to assess learners' understanding. Frame questions that are relevant and useful for the problem context set. Try to be elaborate in conveying the question. Avoid confusing/verbose sentences, jargon, and ambiguity. Try to keep the instructions clear. Remember, if you want to use it for assessment, your questions should be able to give you a clear and measurable answer. ]

Your Hands-on/ Practical activity goes here

[This could be a simulation, a lab protocol, a game, or any other interactive activity that provides learners with hands-on experience of the task]

[What goes here? : Focus on the practical/ micro aspects of the problem. Try to bring out learners' understanding of the underlying mechanisms, causes associated with the problem context.

Create a Google form. This Google form will act as a notepad for the learners and a data collection/assessment tool for you to assess learners' understanding. Frame questions that are relevant and useful for the problem context set. Try to be elaborate in conveying the question. Avoid confusing/verbose sentences, jargon, and ambiguity. Try to keep the instructions clear. Remember, if you want to use it for assessment, your questions should be able to give you a clear and measurable answer. ]

IMViC Test- Principle, Result Chart, Examples, UsesIMViC test is a series of four different biochemical tests used in identifying and differentiating bacteria, especially the members of Enterobacteriaceae.

Summarize it for the learners!

[Your summarising resource goes here.

Provide additional resources for learners to reflect on their actions, validate their findings, and reach a conclusion.

This could be a document, a webpage, a video, a summary table, a diagrammatic representation, an illustration etc.

Also, explain why is it relevant and important for the learners to know. ]

[What goes here? : Bring out the macro-micro connections involved in the topic/phenomena being studied.

Try to help the learners see the connections between all the different phases of the task. Help the learners build a rationale and a scientific explanation. Help them reflect on the process they followed to reach the final conclusion and explain it in their own words.

Use the Google form (in last section of this page) for reporting the findings throughout the task. ]