B-Cell Lymphocyte 2 Protein Implications

A Study of B-Cell Lymphocyte-2 Proteins in Homo sapiens using Bioinformatics

By: Adam Ayyad & Erik Tremblay

Home

This website consists of the B-Cell Lymphocyte in Homo sapiens, this was given by Dr. Bagga of Ramapo College of New Jersey as the final project in Cell & Molecular Biology Lab. The statement below was given by Dr. Paramjeet Bagga Ph.D:

" You have purified a protein by a combination of Molecular Sieve

(Gel-Filtration), Ion-Exchange and affinity chromatography from cultured

HeLa cells. You have been able to determine a partial amino acid sequence of

the purified protein."

Objectives

To study the partial sequence of B-Cell Lymphocytes in Homo sapiens.
- YKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTS

PLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRD

GVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLF

DFSWLSLKTLLSLALVGAC

To determine the gene of a partial Amino Acid sequence
To identify the database for the purified protein sequence
To study the structure and function of BCl-2
To understand mutations that lead to contemporary diseases
To understand drug mechanisms, function and pathways

Google Sites

Report abuse