Q9P144
Homosapiens Y Chromosome Protein
Protein Sequence
>Q9P144|CY014_HUMAN Uncharacterized protein CYorf14 - Homo sapiens (Human)
MYQFMLVYSLPDVYMKRLSANIFHHSACNYEKFSSKKCNLAKLSTNRIGSIMFYVCSILT
LCASLPCRLFRNYRISNFPRVFMKMFRFKELYCFRQNKACSSNRKIHEFQKYH
Primary Structure
Compute pI
Theoretical pI 9.88
Molecular weight 13645.17 (Daltons)
Protparam
Formula C618H951N169O155S13
Sequence Length 113
Total Atoms 1906
Secondary Structure
GOR, HNN & SOPMA
|
GOR |
HNN |
SOPMA |
|||||||
|
Alpha Helix |
Extended Strand |
Random Coil |
Alpha Helix |
Extended Strand |
Random Coil |
Alpha Helix |
Extended Strand |
Beta Turn |
Random Coil |
| 12.39 |
23.89 |
63.72 |
53.98 |
8.85 |
37.17 |
59.29 |
10.62 |
1.77 |
28.32 |
Tertiary Structure Prediction
I-TASSER
3-D Structure predicted By I-tasser server(Ab initio method) = Q9P144
#model : C-score TM-score RMSD (in Angstroms)A2RUG3 : -3.88 0.30 +- 0.10 13.1 +- 4.1
C-score is a confidence score of the I-TASSER predictions which is
typically in [-5,2]. TM-score and RMSD measure how close the model is
to the native structure and both are estimated based on the C-score.
TM-score is in [0,1] with a value >0.5 implying the model of correct
topology. The TM-score and RMSD estimations are made only for the first
model because absolute values of TM-score and RMSD for the lower-rank
models do not strongly correlate with the C-score. The models are
ranked based on the structure density of I-TASSER simulations. Please
cite following articles when you use the I-TASSER server:
1) Yang Zhang. I-TASSER server for protein 3D structure prediction.
BMC Bioinformatics, 9:40 (2008).
2) Yang Zhang. Template-based modeling and free modeling by
I-TASSER in CASP7. Proteins, 8: 108-117 (2007).
3) Sitao Wu, Jeffrey Skolnick, Yang Zhang. Ab initio modeling of
small proteins by iterative TASSER simulations. BMC Biology,
5:17 (2007).
Structure Validation
PROCHECK
Saves Result : Procheck Summary Ramachandran Plot: Plot statistics
Function Prediction
|
Interproscan |
GOG |
Pfam |
Blast |
| Transmembrane Regions | No related Cogs | No hits | No Putative Conserved domains have been detected |
