Q8N4A2
Homosapiens Y Chromosome Protein
Protein Sequence
>Q8N4A2|Q8N4A2_HUMAN CYorf15B protein - Homo sapiens (Human)
MNSHSSSFFFASFICRSVLLTYIILDNKEEHMQQKKEEEEVLKEVTAHFQITLTETQAQL
EQHEIHNAKLQQENMEMGEKLKKLTDQYALREEVNGVWFVYRQLLTSSKSYTLP
Primary Structure
Compute pI
Theoretical pI 5.51
Molecular weight 13485.30 (Daltons)
Protparam
Formula C600H938N158O185S5
Sequence Length 114
Total Atoms 1886
Secondary Structure
GOR, HNN & SOPMA
|
GOR |
HNN |
SOPMA |
|||||||
|
Alpha Helix |
Extended Strand |
Random Coil |
Alpha Helix |
Extended Strand |
Random Coil |
Alpha Helix |
Extended Strand |
Beta Turn |
Random Coil |
| 57.89 |
20.18 |
21.93 |
64.91 |
10.53 |
24.56 |
67.54 |
15.79 |
0.00 |
16.67 |
Tertiary Structure Prediction
I-TASSER
3-D Structure predicted By I-tasser server(Ab initio method) =Q8N4A2
#model : C-score TM-score RMSD (in Angstroms)Q8N4A2 : -2.93 0.38+-0.13 10.7 +- 4.6
C-score is a confidence score of the I-TASSER predictions which is typically in [-5,2]. TM-score and RMSD measure how close the model is to the native structure and both are estimated based on the C-score. TM-score is in [0,1] with a value >0.5 implying the model of correct topology. The TM-score and RMSD estimations are made only for the first model because absolute values of TM-score and RMSD for the lower-rank models do not strongly correlate with the C-score. The models are ranked based on the structure density of I-TASSER simulations. Please cite following articles when you use the I-TASSER server:
1) Yang Zhang. I-TASSER server for protein 3D structure prediction.
BMC Bioinformatics, 9:40 (2008).
2) Yang Zhang. Template-based modeling and free modeling by
I-TASSER in CASP7. Proteins, 8: 108-117 (2007).
3) Sitao Wu, Jeffrey Skolnick, Yang Zhang. Ab initio modeling of
small proteins by iterative TASSER simulations. BMC Biology,
5:17 (2007).
Structure Validation
PROCHECK
Saves Result : Procheck Summary Ramachandran Plot: Plot statistics
Function Prediction
|
Interproscan |
GOG |
Pfam |
Blast |
| Unintegrated |
No relative Cog |
bZIP transcription factor | No putative conserved domains have been identified |
