P25063
Homosapiens Y Chromosome Protein
Protein Sequence
>P25063|CD24_HUMAN Signal transducer CD24 precursor - Homo sapiens (Human)
MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNTGLAPNPTNATTKAAGG
ALQSTASLFVVSLSLLHLYS
Primary Structure
Compute pI
Theoretical pI 9.69
Molecular weight 8097.24 (Daltons)
Protparam
Formula C353H588N96O116S2
Sequence Length 80
Total Atoms 1155
Secondary Structure
GOR, HNN & SOPMA
|
GOR |
HNN |
SOPMA |
|||||||
|
Alpha Helix |
Extended Strand |
Random Coil |
Alpha Helix |
Extended Strand |
Random Coil |
Alpha Helix |
Extended Strand |
Beta Turn |
Random Coil |
| 38.75 |
11.25 |
50.00 |
40.00 |
7.50 |
52.50 |
47.50 |
7.50 |
2.50 |
42.50 |
Tertiary Structure Prediction
I-TASSER
3-D Structure predicted By I-tasser server(Ab initio method) = P25063
#model : C-score TM-score RMSD (in Angstroms)P25063 : -2.94 0.38 +- 0.13 9.9 +- 4.6
C-score is a confidence score of the I-TASSER predictions which is
typically in [-5,2]. TM-score and RMSD measure how close the model is
to the native structure and both are estimated based on the C-score.
TM-score is in [0,1] with a value >0.5 implying the model of correct
topology. The TM-score and RMSD estimations are made only for the first
model because absolute values of TM-score and RMSD for the lower-rank
models do not strongly correlate with the C-score. The models are
ranked based on the structure density of I-TASSER simulations. Please
cite following articles when you use the I-TASSER server:
1) Yang Zhang. I-TASSER server for protein 3D structure prediction.
BMC Bioinformatics, 9:40 (2008).
2) Yang Zhang. Template-based modeling and free modeling by
I-TASSER in CASP7. Proteins, 8: 108-117 (2007).
3) Sitao Wu, Jeffrey Skolnick, Yang Zhang. Ab initio modeling of
small proteins by iterative TASSER simulations. BMC Biology,
5:17 (2007).
Structure Validation
PROCHECK
Saves Result : Procheck Summary Ramachandran Plot: Plot Statistics
Function Prediction
|
Interproscan |
GOG |
Pfam |
Blast |
| Signal Peptide & Transmembrane region | No relative Cog |
No hits reported |
No Hits |
