Protein Sequence
>sp|O14603-2|PRY_HUMAN
Isoform 2 of PTPN13-like protein, Y-linked OS=Homo sapiens GN=PRY
MGATGLGFLLSWRQDNLNGTDCQGCNILYFSETTGSMCSELSLNRGLEARRKKDLKDSFL
WRDGVSPCLPC
Primary Structure
Compute pI
Theoretical pI 6.09
Molecular weight 7877.97 (Daltons)
Protparam
Formula C338H535N97O106S7
Sequence Length 71
Total Atoms 1083
Secondary Structure
GOR, HNN & SOPMA
|
GOR |
HNN |
SOPMA |
|||||||
|
Alpha Helix |
Extended Strand |
Random Coil |
Alpha Helix |
Extended Strand |
Random Coil |
Alpha Helix |
Extended Strand |
Beta Turn |
Random Coil |
| 28.17 |
14.08 |
57.75 |
19.72 |
21.13 |
59.15 |
32.39 |
21.13 |
12.68 |
33.80 |
Tertiary Structure Prediction
I-TASSER
3-D Structure predicted By I-tasser server(Ab initio method) = O14603-2
-----The estimate of O14603-2 -----------
#model : C-score TM-score RMSD (in Angstroms)O14603-2: -2.64 0.41 +- 0.14 8.9 +- 4.6
C-score is a confidence score of the I-TASSER predictions which is
typically in [-5,2]. TM-score and RMSD measure how close the model is
to the native structure and both are estimated based on the C-score.
TM-score is in [0,1] with a value >0.5 implying the model of correct
topology. The TM-score and RMSD estimations are made only for the first
model because absolute values of TM-score and RMSD for the lower-rank
models do not strongly correlate with the C-score. The models are
ranked based on the structure density of I-TASSER simulations. Please
cite following articles when you use the I-TASSER server:
1) Yang Zhang. I-TASSER server for protein 3D structure prediction.
BMC Bioinformatics, 9:40 (2008).
2) Yang Zhang. Template-based modeling and free modeling by
I-TASSER in CASP7. Proteins, 8: 108-117 (2007).
3) Sitao Wu, Jeffrey Skolnick, Yang Zhang. Ab initio modeling of
small proteins by iterative TASSER simulations. BMC Biology,
5:17 (2007).
Structure Validation
PROCHECK
Saves Result : Procheck Summary Ramachandran Plot: Plot Statistics
Function Prediction
|
Interproscan |
GOG |
Pfam |
Blast |
| No Hits reported |
No related Cog |
No hits |
No Putative conserved domains have been detected |
