Protein Sequence

>A2RUG3|XKRY2_HUMAN Testis-specific XK-related protein,Y-linked 2 -Homosapiens  (Human)

MFIFNSIADDIFPLISCVGAIHCNILAIRTGNDFAAIKLQVIKLIYLMIWHSLVIISPVV

TLAFFPASLKQGSLHFLLIIYFVLLLTPWLEFSKSGTHLPSNTKNNSSMVGKYGCLS

Primary Structure

Compute pI

           Theoretical pI        8.91

           Molecular weight    12987.55 (Daltons)

Protparam 

           Formula                      C₆₁₂H₉₅₆N₁₄₄O₁₅₄S₆

               Sequence Length      117

               Total Atoms               1872

_{Secondary Structure}

 _{GOR, HNN & SOPMA}

GOR			HNN			SOPMA
Alpha Helix	Extended Strand	Random Coil	Alpha Helix	Extended Strand	Random Coil	Alpha Helix	Extended Strand	Beta Turn	Random Coil
23.08	27.35	49.57	51.28	13.68	35.04	52.14	24.79	2.56	20.51

_{Tertiary Structure Prediction}

I-TASSER 

3-D Structure predicted By I-tasser server(Ab initio method) = A2RUG3

-----The estimate of  A2RUG3-----------

 #model  : C-score   TM-score      RMSD (in Angstroms)

 A2RUG3 : -3.48      0.33+-0.11   12.2+- 4

      C-score is a confidence score of the I-TASSER predictions which is typically in [-5,2]. TM-score and RMSD measure how close the model is to the native structure and both are estimated based on the C-score. TM-score is in [0,1] with a value >0.5 implying the model of correct topology. The TM-score and RMSD estimations are made only for the first model because absolute values of TM-score and RMSD for the lower-rank models do not strongly correlate with the C-score. The models are ranked based on the structure density of I-TASSER simulations. Please cite following articles when you use the I-TASSER server:

  1) Yang Zhang. I-TASSER server for protein 3D structure prediction.
   BMC Bioinformatics, 9:40 (2008).
  2) Yang Zhang. Template-based modeling and free modeling by
   I-TASSER in CASP7. Proteins, 8: 108-117 (2007).
  3) Sitao Wu, Jeffrey Skolnick, Yang Zhang. Ab initio modeling of
   small proteins by iterative TASSER simulations. BMC Biology,
   5:17 (2007).

Structure Validation

PROCHECK

           Saves Result : Procheck summary                                      Ramachandran Plot: Plot statistics

Function Prediction

Interproscan	GOG	Pfam	Blast
Unintegrated	No relative Cog	No hits	No putative domains

                     Home